PRGDB00172514 (ppa026130m)

From PRG Wiki
Jump to: navigation, search
ppa026130m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

CRINKLY4 related 3 (best arabidopsis hit)

DNA Sequence

ATGGCACTTGTACATCCACCATCTTCTCTCATTATCACCATCATCTTCACAGCCGTCATATCTTCACTGACACCACATGATAGAGTGGTCCATGGCCTTGGCTTAGCTTCTACCACAGCCATCACATATGGCACTTCCACTGTTTGTGGCATTGTGGCAGACAACCCTACACAGAGCATACAATGCTACCAAAACATTCAGACCATTTCAGTCCAGCCCATTGTTTCTTTTGAAGCCATCTCTGGGGGCAAGACCTTCTTCTGTGGCCTCAGGTCTGGTGGCTTTAGCCTTCTCTGTTGGGACACCAGCTTATCTAGCTCATGTAGGTTCCAACCTAAACGCATATATCACAGTGACACAATAGCTTTGACTGATCTGGCTGTAGGTGATGCCCAAGTTTGTGCCAGAGAGGTCAACTCTAGAATTGTCAGGTGCTGGAGAGGAGGAGATGGCACAAGAGGGTCTTTGTTTCCCTCACCTGGGGAAGCATTGGACTTTCATACAATCACATCTGGAAGGGGATTTACATGTGGGATTTTGATGAATGGTAGCAGAGTTCTGTGTTGGGGTCAGAGTAGGGTTGGAGCTGAGATTCAAACAGGGTTTGAGAATGTGTTGATGTCAAGACTAGTTGTTGGAGAGTCTCATGCTTGTGGGTTGAGTGTGAATGGAGCTTTGGTCTGTAAAGGGAACAACGATTCCGGGCAATTGAATGTACCTTCAAGCACTTCAGCTTTTGAGTTTTCAGGCCTTGCATTGGGATCAAATTTTACTTGTGCTATTCGTCGAAGAAATGGCTTTGTTGTATGCTGGGGAGGAAGAAACAGAATTGAATATGACAGTGATGCTATTGAAAATGTTTCATTTGAGTTGATTGCTGCAGGTTTGGATTTTCTTTGCGGCTTAACAACAAGTAATTTATCAATGATTTGTTGGGGACCAGGCTGGACTAGTTCTCAGAATGATCTTCCACTAGGAATGATTGTTCCTGGTCCATGTGTACAAGGTCCATGTAGTAGCTGTGGTGTGTACCCGAATTCGGAGACTCTTTGCGGTGGTTCTGGGAAAATCTGCAAATCATGCCAGATTGAACTTCCAATTGCAGTGCCGTTGCCCCCAATAAATCCGCCGCCACCACAAGTTTCAGCACCGGCTTCTTCATCATCCATAACCAGAAATAGGCTTTTGTTGGCGTTTGCAATAGTTGGATCAGTTGGGGCTTTTACAGGGCTCTGCACTATTATCTTTTGCCTATGGACTAGAAAATGTGGTTCTTGGTCTAACCATCATGATTCTGTGCAACCCACAAGTGCTGTTGCCCCCAATGCTGGTTCTGCAGTTGGGATTGAAAATGATCCTAATGCTCCACCTTCAAGATCAAGTTCCATCAAGGGCTATATAAGCGGCTCATCATCAAAGCATGGAGACAAGACTGAGTCATTTCACCTAGCAGAGCTTTCCGCTGCTACCAAGCACTTCTCATCAGAAAACAAGATTGGTGCTGGGAGCTTTGGTACTGTCTATAAAGGCAAGCTCTCGGACGGTCGCGAAGTGGCCATCAAGAGGGGAGATACTAGTACCAAGACCAAGAAATTTCAGGAGAAAGAGACCGCATTTGATTCCGAATTAGCATTGCTGTCCCGGCTTCACCACAAGCACTTAGTAAAGCTAGTGGGATCCTGTGAAGAGAAAGATGAGAGACTTTTGGTTTACGAGTACATGTGCAACGGTTCACTTCATGATCACTTGCATAGCAAGAAAAATGTTGAGAGAAGTAGCAGCATTGTGAATTCTTGGAGAATGAGGATAAAAATTGCATTGGATGCAGCCAGGGGAATTGAGTATCTGCACAATTATGCAGTGCCAACAATAATTCACAGGGACATTAAGTCCTCAAACATTCTTTTGGATGAAAATTGGACTGCAAGAGTATCTGATTTTGGACTGTCATTACTGGGACCGGAATCTGACCAAGAGATCATGTCATCGAAGGCGGTTGGAACAGTTGGCTACATTGATCCTGAGTACTTTGTATCAAATGTTTTGACAGCAAAGAGTGATGTCTATGGCTTTGGGGTGGTGTTATTGGAGCTTTTGACAGGTAAGAGGGCTGTGTTCAGACTCAGTGAAGAGGGAACAGGTCCAATGGGGGTTGTGGAGTATGCCGGGCCGCGGATGATGGCGGGGGAACTGCAAAGCATTTTGGATCAAAGGGTGGTGCCGCCAGATCCGAATGAAGCTGAAGCAGTTGAGCTGGTGGCTTATACTGCCAGGCATTGTGTGAACTTGGAGGGGAAGGAAAGGCCTAGTATGACTGACATTGTTGCCAATTTGGAAAGGGCACTTGCTCTTTGTGAGGATGAACGTTTTAGCTTCTCTACTACCACAATTTCCCTCCCTTCATTGTGA


Protein sequences

Name Description Sequence
ppa026130m CRINKLY4 related 3 (best arabidopsis hit)

MALVHPPSSLIITIIFTAVISSLTPHDRVVHGLGLASTTAITYGTSTVCGIVADNPTQSIQCYQNIQTISVQPIVSFEAISGGKTFFCGLRSGGFSLLCWDTSLSSSCRFQPKRIYHSDTIALTDLAVGDAQVCAREVNSRIVRCWRGGDGTRGSLFPSPGEALDFHTITSGRGFTCGILMNGSRVLCWGQSRVGAEIQTGFENVLMSRLVVGESHACGLSVNGALVCKGNNDSGQLNVPSSTSAFEFSGLALGSNFTCAIRRRNGFVVCWGGRNRIEYDSDAIENVSFELIAAGLDFLCGLTTSNLSMICWGPGWTSSQNDLPLGMIVPGPCVQGPCSSCGVYPNSETLCGGSGKICKSCQIELPIAVPLPPINPPPPQVSAPASSSSITRNRLLLAFAIVGSVGAFTGLCTIIFCLWTRKCGSWSNHHDSVQPTSAVAPNAGSAVGIENDPNAPPSRSSSIKGYISGSSSKHGDKTESFHLAELSAATKHFSSENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIVANLERALALCEDERFSFSTTTISLPSL*

Domains

Domain Start-End Description Sequence

superfamily: SSF50985
IPR009091
36-313 RCC1/BLIP-II
Regulator of chromosome condensation/beta-lactamas

ASTTAITYGTSTVCGIVADNPTQSIQCYQNIQTISVQPIVSFEAISGGKTFFCGLRSGGFSLLCWDTSLSSSCRFQPKRIYHSDTIALTDLAVGDAQVCAREVNSRIVRCWRGGDGTRGSLFPSPGEALDFHTITSGRGFTCGILMNGSRVLCWGQSRVGAEIQTGFENVLMSRLVVGESHACGLSVNGALVCKGNNDSGQLNVPSSTSAFEFSGLALGSNFTCAIRRRNGFVVCWGGRNRIEYDSDAIENVSFELIAAGLDFLCGLTTSNLSMICWG

HMMPanther: PTHR24420:SF875
47-789 SUBFAMILY NOT NAMED

TVCGIVADNPTQSIQCYQNIQTISVQPIVSFEAISGGKTFFCGLRSGGFSLLCWDTSLSSSCRFQPKRIYHSDTIALTDLAVGDAQVCAREVNSRIVRCWRGGDGTRGSLFPSPGEALDFHTITSGRGFTCGILMNGSRVLCWGQSRVGAEIQTGFENVLMSRLVVGESHACGLSVNGALVCKGNNDSGQLNVPSSTSAFEFSGLALGSNFTCAIRRRNGFVVCWGGRNRIEYDSDAIENVSFELIAAGLDFLCGLTTSNLSMICWGPGWTSSQNDLPLGMIVPGPCVQGPCSSCGVYPNSETLCGGSGKICKSCQIELPIAVPLPPINPPPPQVSAPASSSSITRNRLLLAFAIVGSVGAFTGLCTIIFCLWTRKCGSWSNHHDSVQPTSAVAPNAGSAVGIENDPNAPPSRSSSIKGYISGSSSKHGDKTESFHLAELSAATKHFSSENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIVANLERALALCEDER

HMMPanther: PTHR24420
47-789 FAMILY NOT NAMED,FAMILY NOT NAMED

TVCGIVADNPTQSIQCYQNIQTISVQPIVSFEAISGGKTFFCGLRSGGFSLLCWDTSLSSSCRFQPKRIYHSDTIALTDLAVGDAQVCAREVNSRIVRCWRGGDGTRGSLFPSPGEALDFHTITSGRGFTCGILMNGSRVLCWGQSRVGAEIQTGFENVLMSRLVVGESHACGLSVNGALVCKGNNDSGQLNVPSSTSAFEFSGLALGSNFTCAIRRRNGFVVCWGGRNRIEYDSDAIENVSFELIAAGLDFLCGLTTSNLSMICWGPGWTSSQNDLPLGMIVPGPCVQGPCSSCGVYPNSETLCGGSGKICKSCQIELPIAVPLPPINPPPPQVSAPASSSSITRNRLLLAFAIVGSVGAFTGLCTIIFCLWTRKCGSWSNHHDSVQPTSAVAPNAGSAVGIENDPNAPPSRSSSIKGYISGSSSKHGDKTESFHLAELSAATKHFSSENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIVANLERALALCEDER

Gene3D: G3DSA:2.130.10.30
IPR009091
77-315 no description
Regulator of chromosome condensation/beta-lactamas

FEAISGGKTFFCGLRSGGFSLLCWDTSLSSSCRFQPKRIYHSDTIALTDLAVGDAQVCAREVNSRIVRCWRGGDGTRGSLFPSPGEALDFHTITSGRGFTCGILMNGSRVLCWGQSRVGAEIQTGFENVLMSRLVVGESHACGLSVNGALVCKGNNDSGQLNVPSSTSAFEFSGLALGSNFTCAIRRRNGFVVCWGGRNRIEYDSDAIENVSFELIAAGLDFLCGLTTSNLSMICWGPG

HMMPfam: PF13540
211-236 RCC1_2,Regulator of chromosome condensation (RCC1) repeat

VVGESHACGLSVNGALVCKGNNDSGQ

Seg: seg
365-390 seg

LPIAVPLPPINPPPPQVSAPASSSSI

superfamily: SSF56112
IPR011009
455-778 Protein kinase-like (PK-like)
Protein kinase-like domain

APPSRSSSIKGYISGSSSKHGDKTESFHLAELSAATKHFSSENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIVANL

Seg: seg
458-473 seg

SRSSSIKGYISGSSSK

Gene3D: G3DSA:2.60.120.200
IPR013320
465-512 no description
Concanavalin A-like lectin/glucanase, subgroup

GYISGSSSKHGDKTESFHLAELSAATKHFSSENKIGAGSFGTVYKGKL

HMMSmart: SM00219
IPR020635
493-778 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIVANL

HMMSmart: SM00220
IPR002290
493-782 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIVANLERAL

ProfileScan: PS50011
IPR000719
493-782 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIVANLERAL

HMMPfam: PF00069
IPR000719
495-775 Pkinase,Ser-thr
Protein kinase, catalytic domain

SENKIGAGSFGTVYKGKLSDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEYMCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIV

PatternScan: PS00107
IPR017441
499-521 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGAGSFGTVYKGKLSDGREVAIK

Gene3D: G3DSA:3.30.200.20
513-573 no description

SDGREVAIKRGDTSTKTKKFQEKETAFDSELALLSRLHHKHLVKLVGSCEEKDERLLVYEY

Gene3D: G3DSA:1.10.510.10
574-780 no description

MCNGSLHDHLHSKKNVERSSSIVNSWRMRIKIALDAARGIEYLHNYAVPTIIHRDIKSSNILLDENWTARVSDFGLSLLGPESDQEIMSSKAVGTVGYIDPEYFVSNVLTAKSDVYGFGVVLLELLTGKRAVFRLSEEGTGPMGVVEYAGPRMMAGELQSILDQRVVPPDPNEAEAVELVAYTARHCVNLEGKERPSMTDIVANLER

PatternScan: PS00108
IPR008271
624-636 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox