PRGDB00172515 (ppa004077m)

From PRG Wiki
Jump to: navigation, search
ppa004077m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

plant intracellular ras group-related LRR 1 (best arabidopsis hit)

DNA Sequence

ATGGATCCCAACCCGTCCAACTTCCCCATCCTCTCCTACGTCATGAACCGCCTCCCCTCCTTGGGGACCAAGCACACCGCACCCACCACCCCCATCGCCTCTGACCTCCATTCCATCCACATCGACGCCCACCCACAACCACCATCCAAATCCTCCACCGATCCATCCTCCTCCTCCTCTCAAACCACGATCGTTGACCACATGCCTCACTTGTCCGACCCCAAGGTCCTCGCCTCCATGACCCGGGCCATCTCCGACGTCTCCCAGACCCGCTCCGTTCTCAAAACCCTCGGCGACCGCCCCGACCACGAGGCCGTCGACGTTTCCAAGGCCAGGCTCGCCGCCGTCGATTCCGATTTGGCAAAGAAGCTAGAGGAGCTCGTTCTCTCGCCCCGCCCTGCTGACGTCGACCGACTCCAGTGGCGGGCCCACCTTGCGGAGAGAGAGCAGGAGTGCCGCGAGTCGGCGGAGAAGGAGAAACAAGGTTACAAGGCGATTGTGCAGCTGGATGAGTTGCACTCCGCCTACGAGAAGCTTCTCAAGGACGCCGAGCAGAGGCTCGTCAAGATTTACGAGTCGGCCGAGGCCGGCGTCATCGTCGAAGATGACAAGGTGGAGGAGGAGGGTTTCACCAGCGACCAAGTCCATGAGGAGGTGGTTGGGATTCTACAGGAGGCCTCCGGAACCGAGCTGGACAGGGTCAACCTCTCCGGTCGGCGGTTGCGGTTCTTGCCCGAGGCCTTTGGCCGGATTCGCGGTTTGCTTATGCTCGATCTTTCCAATAATGAACTCCAGGTAATTCCTGATTCAATAGCTGGATTAGAGAAGCTTGAAGAGCTAAATTTGTCTTCGAATCTTCTGGAGGCACTGCCAGACTCAATCGGGATGTTGCAGAATTTGAAGGTCCTGAGTGCCTATGGGAACAAGCTAAGTGCCCTTCCTGACTCTATCTGTCAATGCAGGTCATTGGTGGAGTTGGATGTGAGCTTCAACGGCCTCACATACTTGCCAACCAACATTGGTTTTGAGTTGGTCAATCTACAGAAGCTTTCTATCCAATTAAACAAAATACGTTCCCTTCCCACCTCTGTCTGTGAGTTGAGGTCCTTGCGCTACTTGGATGCTCACTTCAATGAGCTCCGCGGCCTTCCTCTAGCCTTTGGCCGGTTGACCAATCTTCAAATCCTCAATCTCTGCAGTAATTTTACCGATCTCACAGAGCTGCCCGACACTTTCGGTGATTTAACCAACCTCAAGGAACTTGACCTCAGCAACAATCAGATTCATGCTCTTCCAGATACTTTTGGCCGCCTGGACAATTTGACCAAACTTAATGTGGATGGGAACCCTCTTGTGCTTCCACCCCCGGACGTAGTTCAACAAGGTGTGGAAGCTGTCAAGGTTTTCATGGCCAAGAGATGGTTAGAGATACTGGTGGAAGAAGAAAGGAAGAGCATGCTTCAAGTACAAGAACGAGAAGAAACAGGATGGTTGACACGCAGCACTTCCTGGTTGAAGGATTATGTTTCTGGTGTGTCTGAATATATTGGATCTCCAAGAACTGCTAGAGACCCTATTCTTGACCAGCAGCTATGA


Protein sequences

Name Description Sequence
ppa004077m plant intracellular ras group-related LRR 1 (best arabidopsis hit)

MDPNPSNFPILSYVMNRLPSLGTKHTAPTTPIASDLHSIHIDAHPQPPSKSSTDPSSSSSQTTIVDHMPHLSDPKVLASMTRAISDVSQTRSVLKTLGDRPDHEAVDVSKARLAAVDSDLAKKLEELVLSPRPADVDRLQWRAHLAEREQECRESAEKEKQGYKAIVQLDELHSAYEKLLKDAEQRLVKIYESAEAGVIVEDDKVEEEGFTSDQVHEEVVGILQEASGTELDRVNLSGRRLRFLPEAFGRIRGLLMLDLSNNELQVIPDSIAGLEKLEELNLSSNLLEALPDSIGMLQNLKVLSAYGNKLSALPDSICQCRSLVELDVSFNGLTYLPTNIGFELVNLQKLSIQLNKIRSLPTSVCELRSLRYLDAHFNELRGLPLAFGRLTNLQILNLCSNFTDLTELPDTFGDLTNLKELDLSNNQIHALPDTFGRLDNLTKLNVDGNPLVLPPPDVVQQGVEAVKVFMAKRWLEILVEEERKSMLQVQEREETGWLTRSTSWLKDYVSGVSEYIGSPRTARDPILDQQL*


Domains

Domain Start-End Description Sequence

Seg: seg
45-63 seg

PQPPSKSSTDPSSSSSQTT

superfamily: SSF52058
97-461 L domain-like,LRR

LGDRPDHEAVDVSKARLAAVDSDLAKKLEELVLSPRPADVDRLQWRAHLAEREQECRESAEKEKQGYKAIVQLDELHSAYEKLLKDAEQRLVKIYESAEAGVIVEDDKVEEEGFTSDQVHEEVVGILQEASGTELDRVNLSGRRLRFLPEAFGRIRGLLMLDLSNNELQVIPDSIAGLEKLEELNLSSNLLEALPDSIGMLQNLKVLSAYGNKLSALPDSICQCRSLVELDVSFNGLTYLPTNIGFELVNLQKLSIQLNKIRSLPTSVCELRSLRYLDAHFNELRGLPLAFGRLTNLQILNLCSNFTDLTELPDTFGDLTNLKELDLSNNQIHALPDTFGRLDNLTKLNVDGNPLVLPPPDVVQQ

Coil: coil
166-187 coiled-coil

IVQLDELHSAYEKLLKDAEQRL

HMMPanther: PTHR23155:SF34
182-494 LEUCINE-RICH REPEAT-CONTAINING PROTEIN,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DAEQRLVKIYESAEAGVIVEDDKVEEEGFTSDQVHEEVVGILQEASGTELDRVNLSGRRLRFLPEAFGRIRGLLMLDLSNNELQVIPDSIAGLEKLEELNLSSNLLEALPDSIGMLQNLKVLSAYGNKLSALPDSICQCRSLVELDVSFNGLTYLPTNIGFELVNLQKLSIQLNKIRSLPTSVCELRSLRYLDAHFNELRGLPLAFGRLTNLQILNLCSNFTDLTELPDTFGDLTNLKELDLSNNQIHALPDTFGRLDNLTKLNVDGNPLVLPPPDVVQQGVEAVKVFMAKRWLEILVEEERKSMLQVQEREE

HMMPanther: PTHR23155
182-494 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DAEQRLVKIYESAEAGVIVEDDKVEEEGFTSDQVHEEVVGILQEASGTELDRVNLSGRRLRFLPEAFGRIRGLLMLDLSNNELQVIPDSIAGLEKLEELNLSSNLLEALPDSIGMLQNLKVLSAYGNKLSALPDSICQCRSLVELDVSFNGLTYLPTNIGFELVNLQKLSIQLNKIRSLPTSVCELRSLRYLDAHFNELRGLPLAFGRLTNLQILNLCSNFTDLTELPDTFGDLTNLKELDLSNNQIHALPDTFGRLDNLTKLNVDGNPLVLPPPDVVQQGVEAVKVFMAKRWLEILVEEERKSMLQVQEREE

HMMPfam: PF13855
230-287 LRR_8,Leucine rich repeat

ELDRVNLSGRRLRFLPEAFGRIRGLLMLDLSNNELQVIPDSIAGLEKLEELNLSSNLL

Gene3D: G3DSA:3.80.10.10
230-326 no description

ELDRVNLSGRRLRFLPEAFGRIRGLLMLDLSNNELQVIPDSIAGLEKLEELNLSSNLLEALPDSIGMLQNLKVLSAYGNKLSALPDSICQCRSLVEL

HMMSmart: SM00369
IPR003591
251-273 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

IRGLLMLDLSNNELQVIPDSIAG

ProfileScan: PS51450
IPR001611
253-274 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLLMLDLSNNELQVIPDSIAGL

HMMSmart: SM00364
253-270 Leucine-rich repeats, bacterial type

GLLMLDLSNNELQVIPDS

FPrintScan: PR00019
254-267 LEURICHRPT,Leucine-rich repeat signature

LLMLDLSNNELQVI

HMMSmart: SM00369
IPR003591
274-296 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LEKLEELNLSSNLLEALPDSIGM

Seg: seg
274-290 seg

LEKLEELNLSSNLLEAL

HMMSmart: SM00364
274-293 Leucine-rich repeats, bacterial type

LEKLEELNLSSNLLEALPDS

ProfileScan: PS51450
IPR001611
276-297 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEELNLSSNLLEALPDSIGML

HMMSmart: SM00365
297-328 Leucine-rich repeat, SDS22-like subfamily

LQNLKVLSAYGNKLSALPDSICQCRSLVELDV

HMMSmart: SM00364
297-316 Leucine-rich repeats, bacterial type

LQNLKVLSAYGNKLSALPDS

HMMSmart: SM00369
IPR003591
297-320 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQNLKVLSAYGNKLSALPDSICQC

ProfileScan: PS51450
IPR001611
299-320 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKVLSAYGNKLSALPDSICQC

HMMSmart: SM00364
320-339 Leucine-rich repeats, bacterial type

CRSLVELDVSFNGLTYLPTN

HMMSmart: SM00369
IPR003591
321-343 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

RSLVELDVSFNGLTYLPTNIGFE

HMMPfam: PF13855
322-380 LRR_8,Leucine rich repeat

SLVELDVSFNGLTYLPTNIGFELVNLQKLSIQLNKIRSLPTSVCELRSLRYLDAHFNEL

ProfileScan: PS51450
IPR001611
322-343 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVELDVSFNGLTYLPTNIGFE

Gene3D: G3DSA:3.80.10.10
327-460 no description

DVSFNGLTYLPTNIGFELVNLQKLSIQLNKIRSLPTSVCELRSLRYLDAHFNELRGLPLAFGRLTNLQILNLCSNFTDLTELPDTFGDLTNLKELDLSNNQIHALPDTFGRLDNLTKLNVDGNPLVLPPPDVVQ

HMMSmart: SM00365
344-369 Leucine-rich repeat, SDS22-like subfamily

LVNLQKLSIQLNKIRSLPTSVCELRS

HMMSmart: SM00369
IPR003591
344-365 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVNLQKLSIQLNKIRSLPTSVC

HMMSmart: SM00364
344-363 Leucine-rich repeats, bacterial type

LVNLQKLSIQLNKIRSLPTS

ProfileScan: PS51450
IPR001611
346-367 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQKLSIQLNKIRSLPTSVCEL

HMMSmart: SM00364
367-386 Leucine-rich repeats, bacterial type

LRSLRYLDAHFNELRGLPLA

HMMSmart: SM00369
IPR003591
367-389 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLRYLDAHFNELRGLPLAFGR

ProfileScan: PS51450
IPR001611
369-391 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRYLDAHFNELRGLPLAFGRLT

HMMSmart: SM00364
390-411 Leucine-rich repeats, bacterial type

LTNLQILNLCSNFTDLTELPDT

HMMSmart: SM00369
IPR003591
390-414 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLQILNLCSNFTDLTELPDTFGD

HMMPfam: PF13855
391-451 LRR_8,Leucine rich repeat

TNLQILNLCSNFTDLTELPDTFGDLTNLKELDLSNNQIHALPDTFGRLDNLTKLNVDGNPL

ProfileScan: PS51450
IPR001611
392-412 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQILNLCSNFTDLTELPDTF

HMMSmart: SM00365
415-443 Leucine-rich repeat, SDS22-like subfamily

LTNLKELDLSNNQIHALPDTFGRLDNLTK

HMMSmart: SM00369
IPR003591
415-437 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLKELDLSNNQIHALPDTFGR

FPrintScan: PR00019
415-428 LEURICHRPT,Leucine-rich repeat signature

LTNLKELDLSNNQI

HMMSmart: SM00364
415-434 Leucine-rich repeats, bacterial type

LTNLKELDLSNNQIHALPDT

ProfileScan: PS51450
IPR001611
417-438 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKELDLSNNQIHALPDTFGRL

HMMSmart: SM00364
438-456 Leucine-rich repeats, bacterial type

LDNLTKLNVDGNPLVLPPP

HMMSmart: SM00369
IPR003591
438-461 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LDNLTKLNVDGNPLVLPPPDVVQQ

ProfileScan: PS51450
IPR001611
440-461 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTKLNVDGNPLVLPPPDVVQQ

Seg: seg
445-463 seg

NVDGNPLVLPPPDVVQQGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox