PRGDB00172517 (ppa017572m)

From PRG Wiki
Jump to: navigation, search
ppa017572m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

receptor kinase 3 (best arabidopsis hit)

DNA Sequence

ATGAAGAGCCTCATTACTCTCATCTTCTTTGCCTCTCTAATCCAATTTTCAGTCTTGAATTTGTCCACTGCAGCTGATACCATATCTGCATTAGAGTCCATCATGGGCTCAGACACCTTGGTTTCTTCCGGCCAAAGCTTCCAATTAGGACTCTTTTCTGCGGGCAATTCGAAAACCTGGTATCTAGGATTATGGTACAAAAACTTTCCAAATACTGTTGTATGGGTTGCAAACAGAGAGAACCCACTTGCAGGATCAAATGGAGCCTTGACATTAACCAAAAATGGAAGTCTGGTCCTTCTAGACCAAATGAACAACACCATTTGGTCTACCATCTCTTCCCAAATAGTAGAAAATCCTGTTGCACAGCTTTTGGAGACTGGAAACCTTGTTGTCAGAGACAAGGCTGAAACAGGTTCAGAAAACTATATATGGCAAAGCTTCAATTTCCCATCAGATACTCTATTACCAGACATGAAGGTTGGATGGGACTTCAGAACAGGCCTCAACAGATTCTTGACTTCTTGGAAAAATGCTAGTGACCCATCTCTTGGAGAATATACCTATGGGATTGATAATCTGATGTTGCCTCAGCTTGTTGTTGCCGAAGGATCAAAGAAATTGTTCCGTACCGGGCCTTGGAATGGTATTCGATTTACTGGTACTCCTGATGCTGGGAACGAACGAGTTGTGAAACCAATCTATGTGTATGATACAAATGAGTTATATTATATGTATGAGGCTACTGATAGTTCTATTCTAACAAGAGTGAAGCTGTCTGAAACTGGTTTGTCCCAGCGGCTGGTGCTGAAGAAAGGAACCACTGAATGGGATGTTATGTATACTTTGCAGAATGACAGGTGTGACAATTACGGGGAGTGTGGAGCAAATGGAATTTGCAAAACTTCCAATTCTCCAAGTTGTGAGTGCCTGCAGGGGTTTGTTCCGAAATCGCAAAACGAATGGGATGTGCTTAACTGGGAAAGTGGGTGCATTAGGCAGACACCACTGGATTGCCAGAAGGGAGCAGGGTTTTTGAAAGTTCGAAATGTGAAATTGCCAGACCTGCTGGAGTTTTGGGTGAACATGAAAATGAGTGTGGAGGAATGCGAGGCAGAGTGCTTGAGGAATTGTTCTTGTGTAGCTTTTTCTAATACAGATATCCGTAATGGAGGAAGTGGCTGTCTGATGTGGTTTGGCGACCTAATTGATATGCGAGAGTTCGTTGAAGAAGATAGTGAGCAAGATATACACATTAGGTTGCCACTTTCGGAACTTGGTGGCACCGGCAAGAAGGATAAAAGGATTATACTTATCTTGGTCATATCAGCAGTTTCTGTGCTTCCACTTCTAGCTTTGTTATGCTGGTGTATACTTCTGAAGAAGAGAGGAAGGAATGTATCCACATCCGCAGGCTCAAGATCAATTAAGGAGGACTGGGAGTTGCCACTGTTTGATTTTGATACAATTGCAACCGCCACCAATAACTTCTCCCACACAAACAAACTAGGAGAGGGAGGTTTCGGTCAAGTTTACAAGGCCAACCTAACCCGAGAAGAATTCATAGCTGTAAAGAGACTCTCAAAAGAGTCTGGGCAAGGTATTGAAGAGTTTAAGAATGAAGTTACAATGATAGCCAACCTCCAACACTGGAATCTTGTTAAACTTTTGGGCTGCTGCATTCAAGGAGAAGAAAGGATGCTTATCTATGAGTACATGCCCAACAAAAGCTTGGACTGCTTTATTTTCGATCAAAATAGAAAGGTATTGCTGAATTGGCAAAACCGATTGAACATTATCATGGGAATTGCTCGAGGACTTCTCTACCTCCACCAAGACTCCAGATTAAGAATCATTCATAGAGACCTTAAGAGTAGCAACATCTTACTAGATGATGAGCTGAACCCCAAAATATCTGACTTCGGCATAGCAAGGATTTTTGGACGCAATCAAACCGAAGCAAAAACGAAACGAGTAATTGGGACATATGGATATATGTCCCCTGAGTATGCAATTGATGGAAAGTTTTCGGTGAAATCCGATGTGTTCAGTTATGGGGTGCTTCTGTTAGAGATAGTAAGTGGCAGAAAGAACAGAGGGTTTCATCATCCAGATCACCATCACACTCTTCTGGGACATGCATGGTTACTGTGGAATGAAAATAAGGGTTTGGAGCTAATAGATCCTTGCTTGGGGTACTCATATGTTGAGTTTGAGGTGCTGAGGTGCATTCAGGTAGGTCTATTGTGTGTTCAAGCGCTTCCAAAAGACAGACCAGTAATGTCATCAGTGGTTGTCATGTTAAGCAATGAAGGAGTAACATTACCTCAACCAAAGGAGCCAGGATTCTTTACAGAACGAAGTTCCATGGACGATACCATAATTGACGAAGGTAGAAGTAGCCAGACAGGAAGCAGTATTACCATTTCGACAGTGGAAGCTAGATAA


Protein sequences

Name Description Sequence
ppa017572m receptor kinase 3 (best arabidopsis hit)

MKSLITLIFFASLIQFSVLNLSTAADTISALESIMGSDTLVSSGQSFQLGLFSAGNSKTWYLGLWYKNFPNTVVWVANRENPLAGSNGALTLTKNGSLVLLDQMNNTIWSTISSQIVENPVAQLLETGNLVVRDKAETGSENYIWQSFNFPSDTLLPDMKVGWDFRTGLNRFLTSWKNASDPSLGEYTYGIDNLMLPQLVVAEGSKKLFRTGPWNGIRFTGTPDAGNERVVKPIYVYDTNELYYMYEATDSSILTRVKLSETGLSQRLVLKKGTTEWDVMYTLQNDRCDNYGECGANGICKTSNSPSCECLQGFVPKSQNEWDVLNWESGCIRQTPLDCQKGAGFLKVRNVKLPDLLEFWVNMKMSVEECEAECLRNCSCVAFSNTDIRNGGSGCLMWFGDLIDMREFVEEDSEQDIHIRLPLSELGGTGKKDKRIILILVISAVSVLPLLALLCWCILLKKRGRNVSTSAGSRSIKEDWELPLFDFDTIATATNNFSHTNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCIQVGLLCVQALPKDRPVMSSVVVMLSNEGVTLPQPKEPGFFTERSSMDDTIIDEGRSSQTGSSITISTVEAR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-815 FAMILY NOT NAMED,FAMILY NOT NAMED

MKSLITLIFFASLIQFSVLNLSTAADTISALESIMGSDTLVSSGQSFQLGLFSAGNSKTWYLGLWYKNFPNTVVWVANRENPLAGSNGALTLTKNGSLVLLDQMNNTIWSTISSQIVENPVAQLLETGNLVVRDKAETGSENYIWQSFNFPSDTLLPDMKVGWDFRTGLNRFLTSWKNASDPSLGEYTYGIDNLMLPQLVVAEGSKKLFRTGPWNGIRFTGTPDAGNERVVKPIYVYDTNELYYMYEATDSSILTRVKLSETGLSQRLVLKKGTTEWDVMYTLQNDRCDNYGECGANGICKTSNSPSCECLQGFVPKSQNEWDVLNWESGCIRQTPLDCQKGAGFLKVRNVKLPDLLEFWVNMKMSVEECEAECLRNCSCVAFSNTDIRNGGSGCLMWFGDLIDMREFVEEDSEQDIHIRLPLSELGGTGKKDKRIILILVISAVSVLPLLALLCWCILLKKRGRNVSTSAGSRSIKEDWELPLFDFDTIATATNNFSHTNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCIQVGLLCVQALPKDRPVMSSVVVMLSNEGVTLPQPKEPGFFTERSSMDDTIIDEGRSSQTGSSITISTVEAR

HMMPanther: PTHR24420:SF432
1-815 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MKSLITLIFFASLIQFSVLNLSTAADTISALESIMGSDTLVSSGQSFQLGLFSAGNSKTWYLGLWYKNFPNTVVWVANRENPLAGSNGALTLTKNGSLVLLDQMNNTIWSTISSQIVENPVAQLLETGNLVVRDKAETGSENYIWQSFNFPSDTLLPDMKVGWDFRTGLNRFLTSWKNASDPSLGEYTYGIDNLMLPQLVVAEGSKKLFRTGPWNGIRFTGTPDAGNERVVKPIYVYDTNELYYMYEATDSSILTRVKLSETGLSQRLVLKKGTTEWDVMYTLQNDRCDNYGECGANGICKTSNSPSCECLQGFVPKSQNEWDVLNWESGCIRQTPLDCQKGAGFLKVRNVKLPDLLEFWVNMKMSVEECEAECLRNCSCVAFSNTDIRNGGSGCLMWFGDLIDMREFVEEDSEQDIHIRLPLSELGGTGKKDKRIILILVISAVSVLPLLALLCWCILLKKRGRNVSTSAGSRSIKEDWELPLFDFDTIATATNNFSHTNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCIQVGLLCVQALPKDRPVMSSVVVMLSNEGVTLPQPKEPGFFTERSSMDDTIIDEGRSSQTGSSITISTVEAR

ProfileScan: PS50927
IPR001480
25-145 BULB_LECTIN
Bulb-type lectin domain

ADTISALESIMGSDTLVSSGQSFQLGLFSAGNSKTWYLGLWYKNFPNTVVWVANRENPLAGSNGALTLTKNGSLVLLDQMNNTIWSTISSQIVENPVAQLLETGNLVVRDKAETGSENYIW

HMMSmart: SM00108
IPR001480
31-151 Bulb-type mannose-specific lectin
Bulb-type lectin domain

LESIMGSDTLVSSGQSFQLGLFSAGNSKTWYLGLWYKNFPNTVVWVANRENPLAGSNGALTLTKNGSLVLLDQMNNTIWSTISSQIVENPVAQLLETGNLVVRDKAETGSENYIWQSFNFP

superfamily: SSF51110
IPR001480
62-182 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

LGLWYKNFPNTVVWVANRENPLAGSNGALTLTKNGSLVLLDQMNNTIWSTISSQIVENPVAQLLETGNLVVRDKAETGSENYIWQSFNFPSDTLLPDMKVGWDFRTGLNRFLTSWKNASDP

HMMPfam: PF01453
IPR001480
71-183 B_lectin
Bulb-type lectin domain

NTVVWVANRENPLAGSNGALTLTKNGSLVLLDQMNNTIWSTISSQIVENPVAQLLETGNLVVRDKAETGSENYIWQSFNFPSDTLLPDMKVGWDFRTGLNRFLTSWKNASDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
184-221 no description
Bulb-type lectin domain

LGEYTYGIDNLMLPQLVVAEGSKKLFRTGPWNGIRFTG

HMMPfam: PF00954
IPR000858
209-318 S_locus_glycop
S-locus glycoprotein

FRTGPWNGIRFTGTPDAGNERVVKPIYVYDTNELYYMYEATDSSILTRVKLSETGLSQRLVLKKGTTEWDVMYTLQNDRCDNYGECGANGICKTSNSPSCECLQGFVPKS

HMMPfam: PF08276
IPR013227
339-405 PAN_2
PAN-2 domain

CQKGAGFLKVRNVKLPDLLEFWVNMKMSVEECEAECLRNCSCVAFSNTDIRNGGSGCLMWFGDLIDM

ProfileScan: PS50948
IPR003609
339-422 PAN
Apple-like

CQKGAGFLKVRNVKLPDLLEFWVNMKMSVEECEAECLRNCSCVAFSNTDIRNGGSGCLMWFGDLIDMREFVEEDSEQDIHIRLP

HMMSmart: SM00473
IPR003609
340-421 divergent subfamily of APPLE domains
Apple-like

QKGAGFLKVRNVKLPDLLEFWVNMKMSVEECEAECLRNCSCVAFSNTDIRNGGSGCLMWFGDLIDMREFVEEDSEQDIHIRL

Seg: seg
436-460 seg

IILILVISAVSVLPLLALLCWCILL

superfamily: SSF56112
IPR011009
469-791 Protein kinase-like (PK-like)
Protein kinase-like domain

TSAGSRSIKEDWELPLFDFDTIATATNNFSHTNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCIQVGLLCVQALPKDRPVMSSVVVMLSNEGVTLPQPKEPGFFTERSSMD

Gene3D: G3DSA:3.30.200.20
481-558 no description

ELPLFDFDTIATATNNFSHTNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLG

HMMSmart: SM00219
IPR020635
497-768 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSHTNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCIQVGLLCVQALPKDRPVMSSVVVML

HMMSmart: SM00220
IPR002290
497-744 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSHTNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCI

ProfileScan: PS50011
IPR000719
497-773 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSHTNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCIQVGLLCVQALPKDRPVMSSVVVMLSNEGV

HMMPfam: PF07714
IPR001245
500-697 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

TNKLGEGGFGQVYKANLTREEFIAVKRLSKESGQGIEEFKNEVTMIANLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRK

PatternScan: PS00107
IPR017441
503-525 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGQVYKANLTREEFIAVK

Gene3D: G3DSA:1.10.510.10
559-698 no description

CCIQGEERMLIYEYMPNKSLDCFIFDQNRKVLLNWQNRLNIIMGIARGLLYLHQDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSGRKN

PatternScan: PS00108
IPR008271
618-630 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKSSNILL

Seg: seg
702-713 seg

HHPDHHHTLLGH

Seg: seg
800-811 seg

SSQTGSSITIST






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox