PRGDB00172519 (ppa007249m)

From PRG Wiki
Jump to: navigation, search
ppa007249m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGTCAAAGCCATCTGCTGCTATAGTTGGAGGTGCTGCTGGGGCACTTGCCTTGGTGGCAATAGTCATCGGAGTCGTGTGGTTCTACAAGATACATTGCAAGAATCTTTCAAACAAGAATTCAGAGACAGGTTCCTCAGATCCATCTGCAATAGTGGAATGGAGTAGGGGTGGACCCAGTTCCGGGGTACGGCAGGGAGCAAGGCTCTTCACATTGGAGGAGCTAGACCAAGCTACCAAGCATTTTGATGAAAGCAGCCTCCTGGGATATGGAAGCTTTGGCCTGGTTTATAAAGGCTTGCTCCGTGATGGGACGGTTGTGGCTATCAAAAGGCGTCCTGGTGCTCCTAGACAAGAATTTGTCTCAGAGGTAACGTATTTGTCGGAGATTCATCATCGAAATTTAGTTACAATACTGGGTTACTGCCAGGAAAGTGGATTTCAAGTATTGGTATTTGAATATATACCAAACGGCAGCGTGTGCAATCACCTATATGATACTAGACTAGAGTCATCAACTAAACTTGAGTTTAAGCAAAGGCTATCCATAGCTGTAGGGGCTGCAAAAGGGTTGTGCCACTTGCATGGCCTAAAACCTCCCATGGTACACAAAAACTTCAAAACAGCCAATGTCTTGGTTGATGAGGACTTCATTGCCCACGTTGCAGATGCAGGGATTGCAAAACTACTTGAAAAGATTGAAGAAGCAGGTCCTTCTCGCACGTCTAGTGTCAATATTTTCCAAGATCCAGAGGTTGGAGCATCTGGGGTTGCCTCTGAAATGAGTGATGTGCACAGCTTCGGGGTTTTTCTTTTGGAGCTTCTAACTGGACAGGAGGCTTTGGACATTGGCTCCTTGGGATCAAATGAAAGCTTGTTTCAATGGGTGGAATCACGGCTGAGTTCAAATACTCTGGTGGACAGGCGGCTAGCAGGAAGCTTCACTGGAGAGGGAATGAGGGACTTGATCAGGCTGACACTGCAATGCATGAGTTTTCCAGGAAGAAGAAGGCCCAAGATGGAGATGGTTGTGGTTGAGCTTGAGAGAATTAAAGAGAAAGAAATGGCAATGACAACAGTGATGGGGGAGGGTACTGATACATTTGCTCTCGGGAGTGTACTATTCACTTGA


Protein sequences

Name Description Sequence
ppa007249m Protein kinase superfamily protein (best arabidopsis hit)

MSKPSAAIVGGAAGALALVAIVIGVVWFYKIHCKNLSNKNSETGSSDPSAIVEWSRGGPSSGVRQGARLFTLEELDQATKHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPKMEMVVVELERIKEKEMAMTTVMGEGTDTFALGSVLFT*

Domains

Domain Start-End Description Sequence

Seg: seg
6-26 seg

AAIVGGAAGALALVAIVIGVV

HMMPanther: PTHR24420
7-365 FAMILY NOT NAMED,FAMILY NOT NAMED

AIVGGAAGALALVAIVIGVVWFYKIHCKNLSNKNSETGSSDPSAIVEWSRGGPSSGVRQGARLFTLEELDQATKHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPKMEMVVVELERIKEKEMAMTTVMGEGT

HMMPanther: PTHR24420:SF451
7-365 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AIVGGAAGALALVAIVIGVVWFYKIHCKNLSNKNSETGSSDPSAIVEWSRGGPSSGVRQGARLFTLEELDQATKHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPKMEMVVVELERIKEKEMAMTTVMGEGT

superfamily: SSF56112
IPR011009
52-351 Protein kinase-like (PK-like)
Protein kinase-like domain

VEWSRGGPSSGVRQGARLFTLEELDQATKHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPKMEMVVVELERIK

Gene3D: G3DSA:3.30.200.20
64-141 no description

RQGARLFTLEELDQATKHFDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGY

HMMSmart: SM00219
IPR020635
82-347 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPKMEMVVVEL

ProfileScan: PS50011
IPR000719
82-350 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPKMEMVVVELERI

HMMSmart: SM00220
IPR002290
82-356 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDESSLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPKMEMVVVELERIKEKEMA

HMMPfam: PF07714
IPR001245
86-345 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SLLGYGSFGLVYKGLLRDGTVVAIKRRPGAPRQEFVSEVTYLSEIHHRNLVTILGYCQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPKMEMVVV

PatternScan: PS00107
IPR017441
88-110 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGYGSFGLVYKGLLRDGTVVAIK

Gene3D: G3DSA:1.10.510.10
142-339 no description

CQESGFQVLVFEYIPNGSVCNHLYDTRLESSTKLEFKQRLSIAVGAAKGLCHLHGLKPPMVHKNFKTANVLVDEDFIAHVADAGIAKLLEKIEEAGPSRTSSVNIFQDPEVGASGVASEMSDVHSFGVFLLELLTGQEALDIGSLGSNESLFQWVESRLSSNTLVDRRLAGSFTGEGMRDLIRLTLQCMSFPGRRRPK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox