PRGDB00172524 (ppa014934m)

From PRG Wiki
Jump to: navigation, search
ppa014934m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

S-locus lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGATCGGTACTAATTTGCTCTCTCTGTTATTCACACTTTCTTTTGCAGTTGACAGCATTAGTCCCTCCCAGTCTATCCGTGATGGAACGACCTTGGTTTCAAAAGGTGGAAGCTTTGAGCTTGGTTTCTTCAGTCCAGATACTCCCGAGAATCGTTACTTGGGAATTTGGTACAAGAACATCCCAGTTAGAACTGTTGTGTGGGTTGCAAACAGATGCAACCCCATTAATGATTCTTCCGGCATCTTGATGATAAACAGTACGGGACATCTTGTGCTGTTAGGTCAGAATAAGAGTGTCGTTTGGTGGATAAACTCAGCTAAACATGCCCCAAGTGCAACAGTAGAGCTTTTGGATTCTGGGAATTTAGTACTAAGAGATGCAGGAACCTATTTGTGGCAAAGCTTTGACTATCCTTCTGATACGTTGTTACCAGGAATGAAGATGGGATGGGACTTGAGGACAGGTATAAAACGGAGTTTCTCAGCATGGAAAAATTCAGACGACCCGTGTCCAGGAGATTTCACTTATGGGATTGAAATGGAACGTGATACTTATCCTGAGGCATATGTTCGGAAAGGCACTGCAAAATACTATCGTACTGGCCCATGGAATGGCCTGAGATTCAGTGGTTCACCAGAATTAAGGCCTAATCCACTTTATAGTTTCGACTTTGTCTATAATGATGAGGAAGTATACTACATGTACAACCTTCAAAATGAGTCTGTAATCTCAAGAATAGTTTTGAACCAAACCACCAGTACTCGTGATCGCTTGACGTGGATTGAAGCAGATCAAACTTGGAGGGCCTATTCATCAGTACCAAGAGACTGTTGTATCATTGGTGAGAATCCAGTCTGCCAATGTCTAAAAGGATTCAAGCCTAAGTCTCAAGAAAAATGGAATTTGATGGACTGGTCTCTAGGATGTGTGCGCAATAAACCATTAAGCTGCCAGGAAAGATATAAAGATGGCTTTGTCAAATTTGTTGGCTTGAAACTGCCAGATACTACACATTCTTGGGTGAACAAAAGTATGAATCTCAAGGAATGCAGAACCAAATGCTTGAACAACTGTTCCTGTATGGCTTATACAAGCTCGGATATCAGAGGAGGAGGTACTGGCTGCGCCATCTGGTTTGGTGATCTAATAGATATCAGGCAGTTTCCAGCTGCTGGGCAGGATCTTTATATTCGAATGTTGGCTTCAGAATTAGAAAGTGGTGGTAAAGTGAAGACAGCAATGATAATTGCAGTTTCCGTAGCAGTAGTGTTTTCTGTAGTGCTGTTAGTTGGATATTACCTTCACCGAAACAGGAGAAAATTAAAAGGTACATTAACTACCTTAACCATCTTTGCAAAAAAATTGGAACCAGAGGAGGATCTGGAGCTTCCGCTCTTTGACCTGCCCACAGTAGCTAGTGCCACAGATAACTTTTCAAGCAATAACAAGCTCGGAGAAGGTGGATTTGGACCCGTTTACAGGGGGACACTACTAGATGGACAAGAAATTGCTGTGAAGAGGCTTTCAAGAAGTTCTGGCCAAGGATTGAATGAGTTCAAGAATGAAGTTATACTGATTGCAAAGCTTCAGCATCGAAATCTTGTAAAGCTTCTTGGATTCTGCGTTCAAGGAGAGGAGAAAATGCTGATTTATGAATACATGCCCAACAGAAGCCTGGACTCCTTTATTTTTGATAGTGTGAGAGGAGAACTACTGTTAGATTGGCCTAAACGTTTCCATATTATTTGCGGAGTTGCTCGGGGTCTCCTCTATCTCCATCAGGATTCCAGGCTAAGGATTATTCATCGAGATCTCAAAGCAAGTAATGTTTTACTTGATAATGAAATGAATCCAAAAATTTCAGACTTTGGCTTGGCTAGAACATTAATTGGAGGAGATCAGTCTGGTGGAAATACAAACAGAGTAGTTGGAACATACGGTTATATGGCACCTGAATATGCTATTGATGGGCTGTTTTCTGTCAAATCGGATGTATTTAGCTTTGGTATTTTGGTGCTGGAGGTCATAAGTGGACGGAAAAATAAGGGATTCTACCATCCAAACCACAGTCATAACCTTATTGGACATGCATGGAGAATGTGGATTCAAGGAAGGCCTTTAGAACTGATTGATACGTGTTTAGAAAGCTCATGTACTCTATCGGAAGTGTTACGTTGCGTCCATATTAGTCTCTTATGCGTGCAACATCATCCCGAGGATAGACCAAGCATGGCATCTGTGGTTATCATGCTGGGAAGTGAGATTGCATTGGCTCAGCCCAAACAACCTGGTTTCTTTATAGAAAAGGAATCGCATGAAGTAGGCTCTTCTTCAGGTAATCAAAAATCTTCAACAAACGAAATATCGATTACACTTTTGGAGGGCCGTTAA


Protein sequences

Name Description Sequence
ppa014934m S-locus lectin protein kinase family protein (best arabidopsis hit)

MIGTNLLSLLFTLSFAVDSISPSQSIRDGTTLVSKGGSFELGFFSPDTPENRYLGIWYKNIPVRTVVWVANRCNPINDSSGILMINSTGHLVLLGQNKSVVWWINSAKHAPSATVELLDSGNLVLRDAGTYLWQSFDYPSDTLLPGMKMGWDLRTGIKRSFSAWKNSDDPCPGDFTYGIEMERDTYPEAYVRKGTAKYYRTGPWNGLRFSGSPELRPNPLYSFDFVYNDEEVYYMYNLQNESVISRIVLNQTTSTRDRLTWIEADQTWRAYSSVPRDCCIIGENPVCQCLKGFKPKSQEKWNLMDWSLGCVRNKPLSCQERYKDGFVKFVGLKLPDTTHSWVNKSMNLKECRTKCLNNCSCMAYTSSDIRGGGTGCAIWFGDLIDIRQFPAAGQDLYIRMLASELESGGKVKTAMIIAVSVAVVFSVVLLVGYYLHRNRRKLKGTLTTLTIFAKKLEPEEDLELPLFDLPTVASATDNFSSNNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGFCVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSMASVVIMLGSEIALAQPKQPGFFIEKESHEVGSSSGNQKSSTNEISITLLEGR*

Domains

Domain Start-End Description Sequence

Seg: seg
4-15 seg

TNLLSLLFTLSF

HMMPanther: PTHR24420:SF703
6-795 SUBFAMILY NOT NAMED

LLSLLFTLSFAVDSISPSQSIRDGTTLVSKGGSFELGFFSPDTPENRYLGIWYKNIPVRTVVWVANRCNPINDSSGILMINSTGHLVLLGQNKSVVWWINSAKHAPSATVELLDSGNLVLRDAGTYLWQSFDYPSDTLLPGMKMGWDLRTGIKRSFSAWKNSDDPCPGDFTYGIEMERDTYPEAYVRKGTAKYYRTGPWNGLRFSGSPELRPNPLYSFDFVYNDEEVYYMYNLQNESVISRIVLNQTTSTRDRLTWIEADQTWRAYSSVPRDCCIIGENPVCQCLKGFKPKSQEKWNLMDWSLGCVRNKPLSCQERYKDGFVKFVGLKLPDTTHSWVNKSMNLKECRTKCLNNCSCMAYTSSDIRGGGTGCAIWFGDLIDIRQFPAAGQDLYIRMLASELESGGKVKTAMIIAVSVAVVFSVVLLVGYYLHRNRRKLKGTLTTLTIFAKKLEPEEDLELPLFDLPTVASATDNFSSNNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGFCVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSMASVVIMLGSEIALAQPKQPGFFIEKESHEVGSSSGNQKSSTNEISITLLE

HMMPanther: PTHR24420
6-795 FAMILY NOT NAMED,FAMILY NOT NAMED

LLSLLFTLSFAVDSISPSQSIRDGTTLVSKGGSFELGFFSPDTPENRYLGIWYKNIPVRTVVWVANRCNPINDSSGILMINSTGHLVLLGQNKSVVWWINSAKHAPSATVELLDSGNLVLRDAGTYLWQSFDYPSDTLLPGMKMGWDLRTGIKRSFSAWKNSDDPCPGDFTYGIEMERDTYPEAYVRKGTAKYYRTGPWNGLRFSGSPELRPNPLYSFDFVYNDEEVYYMYNLQNESVISRIVLNQTTSTRDRLTWIEADQTWRAYSSVPRDCCIIGENPVCQCLKGFKPKSQEKWNLMDWSLGCVRNKPLSCQERYKDGFVKFVGLKLPDTTHSWVNKSMNLKECRTKCLNNCSCMAYTSSDIRGGGTGCAIWFGDLIDIRQFPAAGQDLYIRMLASELESGGKVKTAMIIAVSVAVVFSVVLLVGYYLHRNRRKLKGTLTTLTIFAKKLEPEEDLELPLFDLPTVASATDNFSSNNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGFCVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSMASVVIMLGSEIALAQPKQPGFFIEKESHEVGSSSGNQKSSTNEISITLLE

ProfileScan: PS50927
IPR001480
17-138 BULB_LECTIN
Bulb-type lectin domain

VDSISPSQSIRDGTTLVSKGGSFELGFFSPDTPENRYLGIWYKNIPVRTVVWVANRCNPINDSSGILMINSTGHLVLLGQNKSVVWWINSAKHAPSATVELLDSGNLVLRDAGTYLWQSFDY

HMMSmart: SM00108
IPR001480
23-139 Bulb-type mannose-specific lectin
Bulb-type lectin domain

SQSIRDGTTLVSKGGSFELGFFSPDTPENRYLGIWYKNIPVRTVVWVANRCNPINDSSGILMINSTGHLVLLGQNKSVVWWINSAKHAPSATVELLDSGNLVLRDAGTYLWQSFDYP

superfamily: SSF51110
IPR001480
48-206 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

TPENRYLGIWYKNIPVRTVVWVANRCNPINDSSGILMINSTGHLVLLGQNKSVVWWINSAKHAPSATVELLDSGNLVLRDAGTYLWQSFDYPSDTLLPGMKMGWDLRTGIKRSFSAWKNSDDPCPGDFTYGIEMERDTYPEAYVRKGTAKYYRTGPWNG

HMMPfam: PF01453
IPR001480
64-170 B_lectin
Bulb-type lectin domain

RTVVWVANRCNPINDSSGILMINSTGHLVLLGQNKSVVWWINSAKHAPSATVELLDSGNLVLRDAGTYLWQSFDYPSDTLLPGMKMGWDLRTGIKRSFSAWKNSDDP

Gene3D: G3DSA:2.90.10.10
IPR001480
172-211 no description
Bulb-type lectin domain

PGDFTYGIEMERDTYPEAYVRKGTAKYYRTGPWNGLRFSG

HMMPfam: PF00954
IPR000858
199-297 S_locus_glycop
S-locus glycoprotein

YRTGPWNGLRFSGSPELRPNPLYSFDFVYNDEEVYYMYNLQNESVISRIVLNQTTSTRDRLTWIEADQTWRAYSSVPRDCCIIGENPVCQCLKGFKPKS

HMMPfam: PF08276
IPR013227
318-386 PAN_2
PAN-2 domain

CQERYKDGFVKFVGLKLPDTTHSWVNKSMNLKECRTKCLNNCSCMAYTSSDIRGGGTGCAIWFGDLIDI

ProfileScan: PS50948
IPR003609
318-401 PAN
Apple-like

CQERYKDGFVKFVGLKLPDTTHSWVNKSMNLKECRTKCLNNCSCMAYTSSDIRGGGTGCAIWFGDLIDIRQFPAAGQDLYIRML

HMMSmart: SM00473
IPR003609
321-400 divergent subfamily of APPLE domains
Apple-like

RYKDGFVKFVGLKLPDTTHSWVNKSMNLKECRTKCLNNCSCMAYTSSDIRGGGTGCAIWFGDLIDIRQFPAAGQDLYIRM

Seg: seg
418-431 seg

AVSVAVVFSVVLLV

Seg: seg
445-450 seg

TLTTLT

superfamily: SSF56112
IPR011009
449-752 Protein kinase-like (PK-like)
Protein kinase-like domain

LTIFAKKLEPEEDLELPLFDLPTVASATDNFSSNNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGFCVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSMASVVIML

Seg: seg
456-470 seg

LEPEEDLELPLFDLP

Gene3D: G3DSA:3.30.200.20
463-541 no description

ELPLFDLPTVASATDNFSSNNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGF

HMMSmart: SM00220
IPR002290
479-752 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSNNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGFCVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSMASVVIML

HMMSmart: SM00219
IPR020635
479-752 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSNNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGFCVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSMASVVIML

ProfileScan: PS50011
IPR000719
479-758 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSNNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGFCVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSMASVVIMLGSEIAL

HMMPfam: PF07714
IPR001245
482-750 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NNKLGEGGFGPVYRGTLLDGQEIAVKRLSRSSGQGLNEFKNEVILIAKLQHRNLVKLLGFCVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSMASVVI

Gene3D: G3DSA:1.10.510.10
542-745 no description

CVQGEEKMLIYEYMPNRSLDSFIFDSVRGELLLDWPKRFHIICGVARGLLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGTYGYMAPEYAIDGLFSVKSDVFSFGILVLEVISGRKNKGFYHPNHSHNLIGHAWRMWIQGRPLELIDTCLESSCTLSEVLRCVHISLLCVQHHPEDRPSM

PatternScan: PS00108
IPR008271
601-613 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox