PRGDB00172531 (ppa026371m)

From PRG Wiki
Jump to: navigation, search
ppa026371m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

receptor-like kinase in flowers 1 (best arabidopsis hit)

DNA Sequence

ATGGAAGCACTAGAAGAAATAGCAAAACAACTGGGGAAAACGGACTGGAACTTCAACATAAACCCATGCAACAATAACACAAACTGGGATACCCCAAAATCTACTGCCAACCCTCTCTACAACAACACCCTCGAATGCAACTGCTCCTATCGCGGCGGGTTTTGCCACGTTGTCGGCATTTTTCTTAAAGGGCAAGATCTTGCTGGTGTACTTCCACCATCTGTTGCAAAGTTGCCCTACATAACACAAGTTGATTTCACCAGGAACTACCTCAGTGGTCCTATACCGTCTGAATGGGCTTCTACAAAGTTGGAACATCTGTCCGTGAATGTGAACAACTTATCAGGACAAATCCCTTCCTTCTTGGGGAACATTAAAACTCTAATCTATCTGAACTTACAGACTAACCTGTTTTCTGGAACTGTTCCTCATGAGCTTGGGAATTTGGTTAACCTGGAGCTTTTCATTCTCAGTTCAAACTATCTCACAGGAGAATTGCCAGTGGCTTTCACTAATCTGACTAAATTAAGAGAATTTAGGATTAGCAGTAACAACTTCACGGGAAGAATACCTGATTATTTGGGAAATTTTAAACAACTTGAGAAATTAGAGATCCAAGCTAGTGGTCTCCATGGGCCCATTCCGTCTAGCATTTCTGTCTTGAGTAATTTAAAAGAACTAAGGGTCAGTGACTTAAATGGAGGGGGTTCAAAATTTCCAAACTTGAGTAATATAACGGGCATGACAGACTTAATGCTGAGGAGCTGCAATTTATATGGACCTATCCCTGCTTATATATCAACAATGGAAAATTTGAAGAAATTAGATCTCAGCTTCAACAAATTGGAAGGAAATATTAATACTCCTGACTATGAACATCTGCAACACGTGCAGTACTTGTATCTAACAAGCAACTGGCTCAACGGGTCTGTTCCAGAATGGATCAAGATTAGAGATAATCGCTACCTGACAGATATTTCTTACAATAATTTTTCTGAGAGCTCTGAGCCACCTACTTGCCCAGAAACACTCACACTTTGGTGTCTTCATTCACCTATAATAATGCATTTTTCTTTGAAATATTTATCAGAAACGTGTTTAAAAGCTTTTCTGCACAAAGAAACCTATAAGTCCTCGTTGCATATAAATTGTGGTGGAAAACAAACCACCATTGAAGGAGTCACCTTTGAAGACGATCAAGACCAAGGAGGTGCAGCAAAATTCTTTCCTCAGAGACCTATCTGGGGAACCAGTAGCACTGGACATTTCTGGGATTCTGCCTCCAATGCTACAGCCTACATTGCAAATAATGTATCTATACTTAGAATGAACAACGCTGAGTTGTACACAAATGCACGCATCAATCCTCTTTCTCTCACGTATTATGCACGCTGCTTTCGAAACGGCAATTACACCGTGAAACTTCACTTCTCAGAGATAACGATCAGAGGCAACAGATCTTTTCGTAGTGTTGGAAGACGGATATTTGATATTTATATTCAGGAGAAACTGGTGTGGAAGGATTTTGAAATTAAAAAGGAAGCACACGGCGTTGATAAAGAACTCATTAAGGAATGTAAAGCAGTTGAGGTTAAGAATAAAACTTTAGAGATCCGATTTCATTGGTCTGGGAAAGGGACAACAGCTTCTCCAAAGACTGGAACATATGGTGCTCTAATATCTGCTATCTCTGTAGAGCCTGCGCTGAGAGGACTGGATCTGCAAACTGGTTTTTTCACCTTCAAGCAAATTAAAGCCGCCACTAATAACTTTGATCCTATAAACAAAATCGGGGAAGGCGGTTTTGGATCTGTCTACAAGGGTATATTATTGGACGGTACTATAATTGCAGTTAAGCAACTATCATCCAAATCAAAGCAAGGAAATCGGGAATTTGTGAATGAAATAGGCATGATTTCTGGTTTACAACATCCAAATCTTGTTAGATTGTATGGATGCTGTGTTGAATCAAACCAGTTACTGTTGGTATATGAATACATGGAAAACAACAGCCTTGCACGTGCTTTGTTCGTTCCAGAGGAAAGTCCTTTAAAATTGGACTGGCCTACAAGGCAGAATATATGCATAGGCATAGCAAGAGGTCTGGCTTTTTTGCATGAAGAATCTGCACTGAAGATTGTACATAGAGACATTAAAACTACAAATATATTACTAGACCGAGACCTTAACTCCAAGATCTCGGACTTTGGGTTGGCCAAGCTTGACGAAGAGGAGAACACCCACATTAGCACTAGAGTTGCTGGAACTATAGGATATATGGCGCCAGAATATGCACTATGGGGTTATTTGACCTACAAAGCAGATGTCTACAGCTTTGGTGTTGTTGCATTGGAGATTGTTGCTGGAAAGAACAACATGAAATATCGACCAAATGAGAACTTTGTATGCCTTGTAGATTGGGCTCTTGTTTTACAACAAAAAGGGGAATTATTGGAGCTGGTGGATCCAAGATTGGGGTCCGATGTGAGTGAGGAAGAGGCCATTAGGATGATTAAAGTTGCTCTCTTATGCATCAATGCAGCACCAGCGCTTAGGCCTACCATGTCTGCAGTAGTGAGTATGCTTGAAGGGCGGACGGCTGTTCATGAATTGGTCACGGATCCAAGTACTTACGGTGATGAACTGAGGCTAACAGCCTTGACAAACCAGTTTGATCACAGTTCATCACAGAATCCAAGTCAAACTCAGAGCCTTGTTCCTTCATCATCAGATGCGCCATGGATTGGTTCCTCTGCTACTACTACGTCTTCTGATCTCTATAAAATCAATCCCAGTACTAGTTCTTACTAA


Protein sequences

Name Description Sequence
ppa026371m receptor-like kinase in flowers 1 (best arabidopsis hit)

MEALEEIAKQLGKTDWNFNINPCNNNTNWDTPKSTANPLYNNTLECNCSYRGGFCHVVGIFLKGQDLAGVLPPSVAKLPYITQVDFTRNYLSGPIPSEWASTKLEHLSVNVNNLSGQIPSFLGNIKTLIYLNLQTNLFSGTVPHELGNLVNLELFILSSNYLTGELPVAFTNLTKLREFRISSNNFTGRIPDYLGNFKQLEKLEIQASGLHGPIPSSISVLSNLKELRVSDLNGGGSKFPNLSNITGMTDLMLRSCNLYGPIPAYISTMENLKKLDLSFNKLEGNINTPDYEHLQHVQYLYLTSNWLNGSVPEWIKIRDNRYLTDISYNNFSESSEPPTCPETLTLWCLHSPIIMHFSLKYLSETCLKAFLHKETYKSSLHINCGGKQTTIEGVTFEDDQDQGGAAKFFPQRPIWGTSSTGHFWDSASNATAYIANNVSILRMNNAELYTNARINPLSLTYYARCFRNGNYTVKLHFSEITIRGNRSFRSVGRRIFDIYIQEKLVWKDFEIKKEAHGVDKELIKECKAVEVKNKTLEIRFHWSGKGTTASPKTGTYGALISAISVEPALRGLDLQTGFFTFKQIKAATNNFDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDELRLTALTNQFDHSSSQNPSQTQSLVPSSSDAPWIGSSATTTSSDLYKINPSTSSY*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
6-927 FAMILY NOT NAMED,FAMILY NOT NAMED

EIAKQLGKTDWNFNINPCNNNTNWDTPKSTANPLYNNTLECNCSYRGGFCHVVGIFLKGQDLAGVLPPSVAKLPYITQVDFTRNYLSGPIPSEWASTKLEHLSVNVNNLSGQIPSFLGNIKTLIYLNLQTNLFSGTVPHELGNLVNLELFILSSNYLTGELPVAFTNLTKLREFRISSNNFTGRIPDYLGNFKQLEKLEIQASGLHGPIPSSISVLSNLKELRVSDLNGGGSKFPNLSNITGMTDLMLRSCNLYGPIPAYISTMENLKKLDLSFNKLEGNINTPDYEHLQHVQYLYLTSNWLNGSVPEWIKIRDNRYLTDISYNNFSESSEPPTCPETLTLWCLHSPIIMHFSLKYLSETCLKAFLHKETYKSSLHINCGGKQTTIEGVTFEDDQDQGGAAKFFPQRPIWGTSSTGHFWDSASNATAYIANNVSILRMNNAELYTNARINPLSLTYYARCFRNGNYTVKLHFSEITIRGNRSFRSVGRRIFDIYIQEKLVWKDFEIKKEAHGVDKELIKECKAVEVKNKTLEIRFHWSGKGTTASPKTGTYGALISAISVEPALRGLDLQTGFFTFKQIKAATNNFDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDELRLTALTNQFDHSSSQNPSQTQSLVPSSSDAPWIGSSATTTSSDLY

HMMPanther: PTHR24420:SF692
6-927 LEUCINE-RICH REPEAT FAMILY PROTEIN / PROTEIN KINASE FAMILY PROTEIN

EIAKQLGKTDWNFNINPCNNNTNWDTPKSTANPLYNNTLECNCSYRGGFCHVVGIFLKGQDLAGVLPPSVAKLPYITQVDFTRNYLSGPIPSEWASTKLEHLSVNVNNLSGQIPSFLGNIKTLIYLNLQTNLFSGTVPHELGNLVNLELFILSSNYLTGELPVAFTNLTKLREFRISSNNFTGRIPDYLGNFKQLEKLEIQASGLHGPIPSSISVLSNLKELRVSDLNGGGSKFPNLSNITGMTDLMLRSCNLYGPIPAYISTMENLKKLDLSFNKLEGNINTPDYEHLQHVQYLYLTSNWLNGSVPEWIKIRDNRYLTDISYNNFSESSEPPTCPETLTLWCLHSPIIMHFSLKYLSETCLKAFLHKETYKSSLHINCGGKQTTIEGVTFEDDQDQGGAAKFFPQRPIWGTSSTGHFWDSASNATAYIANNVSILRMNNAELYTNARINPLSLTYYARCFRNGNYTVKLHFSEITIRGNRSFRSVGRRIFDIYIQEKLVWKDFEIKKEAHGVDKELIKECKAVEVKNKTLEIRFHWSGKGTTASPKTGTYGALISAISVEPALRGLDLQTGFFTFKQIKAATNNFDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDELRLTALTNQFDHSSSQNPSQTQSLVPSSSDAPWIGSSATTTSSDLY

Seg: seg
17-28 seg

NFNINPCNNNTN

Gene3D: G3DSA:3.80.10.10
32-313 no description

PKSTANPLYNNTLECNCSYRGGFCHVVGIFLKGQDLAGVLPPSVAKLPYITQVDFTRNYLSGPIPSEWASTKLEHLSVNVNNLSGQIPSFLGNIKTLIYLNLQTNLFSGTVPHELGNLVNLELFILSSNYLTGELPVAFTNLTKLREFRISSNNFTGRIPDYLGNFKQLEKLEIQASGLHGPIPSSISVLSNLKELRVSDLNGGGSKFPNLSNITGMTDLMLRSCNLYGPIPAYISTMENLKKLDLSFNKLEGNINTPDYEHLQHVQYLYLTSNWLNGSVPE

superfamily: SSF52058
37-317 L domain-like,LRR

NPLYNNTLECNCSYRGGFCHVVGIFLKGQDLAGVLPPSVAKLPYITQVDFTRNYLSGPIPSEWASTKLEHLSVNVNNLSGQIPSFLGNIKTLIYLNLQTNLFSGTVPHELGNLVNLELFILSSNYLTGELPVAFTNLTKLREFRISSNNFTGRIPDYLGNFKQLEKLEIQASGLHGPIPSSISVLSNLKELRVSDLNGGGSKFPNLSNITGMTDLMLRSCNLYGPIPAYISTMENLKKLDLSFNKLEGNINTPDYEHLQHVQYLYLTSNWLNGSVPEWIKI

HMMPfam: PF13855
249-305 LRR_8,Leucine rich repeat

TDLMLRSCNLYGPIPAYISTMENLKKLDLSFNKLEGNINTPDYEHLQHVQYLYLTSN

HMMPfam: PF11721
IPR021720
379-563 Malectin
Malectin

SLHINCGGKQTTIEGVTFEDDQDQGGAAKFFPQRPIWGTSSTGHFWDSASNATAYIANNVSILRMNNAELYTNARINPLSLTYYARCFRNGNYTVKLHFSEITIRGNRSFRSVGRRIFDIYIQEKLVWKDFEIKKEAHGVDKELIKECKAVEVKNKTLEIRFHWSGKGTTASPKTGTYGALISAI

superfamily: SSF56112
IPR011009
561-870 Protein kinase-like (PK-like)
Protein kinase-like domain

SAISVEPALRGLDLQTGFFTFKQIKAATNNFDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHE

Gene3D: G3DSA:3.30.200.20
578-653 no description

FFTFKQIKAATNNFDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGC

ProfileScan: PS50011
IPR000719
591-872 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELV

HMMSmart: SM00220
IPR002290
591-872 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELV

HMMSmart: SM00219
IPR020635
591-862 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSML

HMMPfam: PF00069
IPR000719
594-800 Pkinase,Ser-thr
Protein kinase, catalytic domain

INKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEN

PatternScan: PS00107
IPR017441
597-619 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGSVYKGILLDGTIIAVK

Gene3D: G3DSA:1.10.510.10
654-862 no description

CVESNQLLLVYEYMENNSLARALFVPEESPLKLDWPTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSML

PatternScan: PS00108
IPR008271
713-725 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKTTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox