PRGDB00172532 (ppa019571m)

From PRG Wiki
Jump to: navigation, search
ppa019571m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Protein kinase family protein with leucine-rich repeat domain (best arabidopsis hit)

DNA Sequence

ATGACTAAACCAACCCCAACATCTTCTCTCCACACCCATCTCTGCGTCCTGCTCTTCCTCCCCCTCCTCCTCATCAGCCATGCCAACTCTCAGTCATTGCAAGACCAAGAACAAGCTGTTCTGCTAAAACTAAAGTCATACTTGCAATCTCCACCGTTCCTCAGCCATTGGATTCCATCAACATCAAACACTTCCCACTGTTCCTGGCGGCCTGAGATCACCTGCACAAACAACTCTGTCACCGGATTGTCTCTGGTCAACATGAACATCACCCTACCAGTTCCACCTTTCATTTGTGATCTCAAGAACCTCACACTCATTGATCTCAGCTACAACTACTTTGCTGGAGAGTTCCCAAAAGCTTTCAACAACTGTTCAAAGCTACAGTACTTAAATCTCTCTCAAAACTCCTTTGATGGCAAGATTCCTGACGATATCGACAGCTTGCCTCGGCTACAATACCTTGACCTTAACGCTAACTACTTTTCGGGTGACATACCGGCGGCTATTGGGAGGTTACAAGAGCTCAGGAACCTGCAGCTGTATATGAACCACTTTAATGGTTCCGTGCCACCAGAAATAGGTAACTTGTCCAATCTTAAACACCTAAGTCTCTCTTTCAATACAAAACTTGTGCCATGGAATTTGCCGTCCAATTTCACCAAGTTGAAAAACTTGAAGACTTTGCATATACATGGATCGAATTTGATTGGAGAGCTCCCCGGAACACTTGGAGAAATGGCAGCACTGGAAGAATTGGATTTGGCAACCAACAGTTTAAATGGGACAATCCCAAATGGTTTGTTTCTCTTGAAGAATTTGAGCATAATCTACCTCTTCAACAACAGCCTGTCTGGGCATGTACCTCAAGTGGTTGAAGCATTGAACTTGAGTATTATTGATATTTCTGGCAACGATTTAACTGGGCCAATACCAGAAGATTATGGAAACCTTACCAAGTTAACAGAGTTAGCTTTGTTTTTAAATGGTTTTTCTGGTGCGGTTCCAGCAAGCATTGGCCGTCTACCAAATCTCAAACAGTTCAGAGTGTTCATCAATAATTTGTCTGGAACATTGCCTCCAGACTTGGGAAGGTATTCAGAGCTTGAAGGGTTCGAGGTTTCGGGGAATAGGCTCACTGGCAAACTGCCAGACCATTTGTGCTATCGGGGTAAGCTGTCAACACTTGTAGCTTATGAGAACAATCTCACTGGGGAGTTACCAAGCTCTCTTGGAAATTGCACTAGTTTAACAGAAGTGAAGGTTTCTGATAATGGATTGTCTGGGAACATACCTAGTGGCTTGTGGACAGCACCAAACTTGAGTCAGGTGCTGATGAGCAACAACTCTCTTACTGGCGAGCTTCCTGAGAAAATATCTCAGAATCTTACACGGCTGGAAATCAGAGATAACAGATTTTCAGGTAACATTCCAACCGGGGTGTCATCCTGGAACTTGAAGGTTTTTGACGCTGGTAATAACCTTTTTAACGGTACTATCCCTCAGGAACTCACTGCTCTTCGTAGCTTAATCACTCTTTCTCTTGATCAGAATCAGCTTACTGGCTTCCTTCCATCAGAGATTATGTCATGGGAATCACTCAACATTCTTAATTTCAGTCGAAATCAACTCTCTGGACCAATTCCAGCGAGACTTGGTCTTCTACCAGTCCTTACTGCACTGGACCTTTCAGAAAACCAACTTTCTGGCCAAATTCCAGCTCAACTTGGGCATCTGAAGCTCAGCAACTTCAATCTCTCTTCCAATCACCTATCTGGGAAGATCCCAATTGAATTTGAAAATCCTGCTTATGACGGAAGCTTCTTGGACAATCAAGATCTCTGTGCAACTAGCCCCTCAGCAAAACTCAGCATATGTAATTCTCAACCTCGAAAGTCCAGCAAAATTTGGTCTACATATCTTGCATTGATCTTAACTTTCGGCATACTTTTGTCCTTGTTGGCTTTGTCCTTATCATTCTTCATGGTCAGAGCTTATTGGAAGAGAAACAGATCGGATTTTGATTGGAAGCTCACCGCTTTTCAGAGGTTGAATTTCAGAGTGTCAAAAATTCTCTCAGGATTGACAGAAAGTAATATGATTGGAAGTGGCGGCTCAGGAAAAGTTTATTGTGTTCCTGTCAATCGTACAGGCGATGTTGTTGCCGTGAAAAAGATTTGGAAAGATAAGAAGTTAGAAGAGAAGCTTGAAAAAGAATTTCTTGCAGAAGTCAAGATATTGAGTTCCATTCGACATGCCAACATAGTGAAGCTGATGTGCTGTATATCCAAGGACAATTCAAAACTACTTGTCTATGAGTACTCGGAGAATCGAAGTCTGGATCGATGGCTGCACAAGAGAAACAGGCCATCCAATCTCTCTAGGTCAGTCCACCATGTTGTGCTGGACTGGCCTAAGAGGTTGCATATTGCAGTGGGGGCTGCTCAGGGCCTCCACTATATGCATCATGACTGTGTGCCGCCCGTTGTGCATCGAGATGTGAAATCGAGTAACATCTTGTTAGACTCTGATTTTAATGCAAAAATAGCAGATTTTGGTCTAGCCAAGATGTTGGTCAAGCAAGGAGAACTTGCTACAATGTCGGCTGTTGCTGGCTCCTTTGGCTACATTGCTCCAGAATGTGCTCATACGATACGTGTGAATGAGAAGATTGATGTATATAGTTTTGGGGTCGTCCTTCTGGAGTTGACCACCGGAAGGGAAGCTAATGATAGCGACGAACACACTGCTCTTGCCGAATGGGCATGGCGCCATGTTCAAGAAGACAACCCTCTTGCCGATGCTTTGGACAAGGACATCAAAGAACCTTGCTACTTGGATGAAATGTGCTCCGTTTTCAGACTTGGCATCTATTGCACCGAGAAACTTCCTTCTACTAGGCCTTCCATGAAGGAGGTTCTGCAAATCTTGCTCCGATGCGGCCATCCAGGAGTTCACAGAGAAAATACTGATTATGTTGGTGCTCCTCTGCTCAAGAATTCGAAGCGCGAGCAGATACTGGAAGACGGTGTTGGTAGTTCGGCAACAAATGTTTGA


Protein sequences

Name Description Sequence
ppa019571m Protein kinase family protein with leucine-rich repeat domain (best arabidopsis hit)

MTKPTPTSSLHTHLCVLLFLPLLLISHANSQSLQDQEQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWRPEITCTNNSVTGLSLVNMNITLPVPPFICDLKNLTLIDLSYNYFAGEFPKAFNNCSKLQYLNLSQNSFDGKIPDDIDSLPRLQYLDLNANYFSGDIPAAIGRLQELRNLQLYMNHFNGSVPPEIGNLSNLKHLSLSFNTKLVPWNLPSNFTKLKNLKTLHIHGSNLIGELPGTLGEMAALEELDLATNSLNGTIPNGLFLLKNLSIIYLFNNSLSGHVPQVVEALNLSIIDISGNDLTGPIPEDYGNLTKLTELALFLNGFSGAVPASIGRLPNLKQFRVFINNLSGTLPPDLGRYSELEGFEVSGNRLTGKLPDHLCYRGKLSTLVAYENNLTGELPSSLGNCTSLTEVKVSDNGLSGNIPSGLWTAPNLSQVLMSNNSLTGELPEKISQNLTRLEIRDNRFSGNIPTGVSSWNLKVFDAGNNLFNGTIPQELTALRSLITLSLDQNQLTGFLPSEIMSWESLNILNFSRNQLSGPIPARLGLLPVLTALDLSENQLSGQIPAQLGHLKLSNFNLSSNHLSGKIPIEFENPAYDGSFLDNQDLCATSPSAKLSICNSQPRKSSKIWSTYLALILTFGILLSLLALSLSFFMVRAYWKRNRSDFDWKLTAFQRLNFRVSKILSGLTESNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRWLHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQILLRCGHPGVHRENTDYVGAPLLKNSKREQILEDGVGSSATNV*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF789
1-980 SUBFAMILY NOT NAMED

MTKPTPTSSLHTHLCVLLFLPLLLISHANSQSLQDQEQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWRPEITCTNNSVTGLSLVNMNITLPVPPFICDLKNLTLIDLSYNYFAGEFPKAFNNCSKLQYLNLSQNSFDGKIPDDIDSLPRLQYLDLNANYFSGDIPAAIGRLQELRNLQLYMNHFNGSVPPEIGNLSNLKHLSLSFNTKLVPWNLPSNFTKLKNLKTLHIHGSNLIGELPGTLGEMAALEELDLATNSLNGTIPNGLFLLKNLSIIYLFNNSLSGHVPQVVEALNLSIIDISGNDLTGPIPEDYGNLTKLTELALFLNGFSGAVPASIGRLPNLKQFRVFINNLSGTLPPDLGRYSELEGFEVSGNRLTGKLPDHLCYRGKLSTLVAYENNLTGELPSSLGNCTSLTEVKVSDNGLSGNIPSGLWTAPNLSQVLMSNNSLTGELPEKISQNLTRLEIRDNRFSGNIPTGVSSWNLKVFDAGNNLFNGTIPQELTALRSLITLSLDQNQLTGFLPSEIMSWESLNILNFSRNQLSGPIPARLGLLPVLTALDLSENQLSGQIPAQLGHLKLSNFNLSSNHLSGKIPIEFENPAYDGSFLDNQDLCATSPSAKLSICNSQPRKSSKIWSTYLALILTFGILLSLLALSLSFFMVRAYWKRNRSDFDWKLTAFQRLNFRVSKILSGLTESNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRWLHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQILLRC

HMMPanther: PTHR24420
1-980 FAMILY NOT NAMED,FAMILY NOT NAMED

MTKPTPTSSLHTHLCVLLFLPLLLISHANSQSLQDQEQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWRPEITCTNNSVTGLSLVNMNITLPVPPFICDLKNLTLIDLSYNYFAGEFPKAFNNCSKLQYLNLSQNSFDGKIPDDIDSLPRLQYLDLNANYFSGDIPAAIGRLQELRNLQLYMNHFNGSVPPEIGNLSNLKHLSLSFNTKLVPWNLPSNFTKLKNLKTLHIHGSNLIGELPGTLGEMAALEELDLATNSLNGTIPNGLFLLKNLSIIYLFNNSLSGHVPQVVEALNLSIIDISGNDLTGPIPEDYGNLTKLTELALFLNGFSGAVPASIGRLPNLKQFRVFINNLSGTLPPDLGRYSELEGFEVSGNRLTGKLPDHLCYRGKLSTLVAYENNLTGELPSSLGNCTSLTEVKVSDNGLSGNIPSGLWTAPNLSQVLMSNNSLTGELPEKISQNLTRLEIRDNRFSGNIPTGVSSWNLKVFDAGNNLFNGTIPQELTALRSLITLSLDQNQLTGFLPSEIMSWESLNILNFSRNQLSGPIPARLGLLPVLTALDLSENQLSGQIPAQLGHLKLSNFNLSSNHLSGKIPIEFENPAYDGSFLDNQDLCATSPSAKLSICNSQPRKSSKIWSTYLALILTFGILLSLLALSLSFFMVRAYWKRNRSDFDWKLTAFQRLNFRVSKILSGLTESNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRWLHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQILLRC

Seg: seg
10-27 seg

LHTHLCVLLFLPLLLISH

superfamily: SSF52058
31-295 L domain-like,LRR

QSLQDQEQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWRPEITCTNNSVTGLSLVNMNITLPVPPFICDLKNLTLIDLSYNYFAGEFPKAFNNCSKLQYLNLSQNSFDGKIPDDIDSLPRLQYLDLNANYFSGDIPAAIGRLQELRNLQLYMNHFNGSVPPEIGNLSNLKHLSLSFNTKLVPWNLPSNFTKLKNLKTLHIHGSNLIGELPGTLGEMAALEELDLATNSLNGTIPNGLFLLKNLSIIYLFNNSLSGHVPQVVEAL

Gene3D: G3DSA:3.80.10.10
35-208 no description

DQEQAVLLKLKSYLQSPPFLSHWIPSTSNTSHCSWRPEITCTNNSVTGLSLVNMNITLPVPPFICDLKNLTLIDLSYNYFAGEFPKAFNNCSKLQYLNLSQNSFDGKIPDDIDSLPRLQYLDLNANYFSGDIPAAIGRLQELRNLQLYMNHFNGSVPPEIGNLSNLKHLSLSFN

HMMSmart: SM00369
IPR003591
101-124 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLTLIDLSYNYFAGEFPKAFNN

HMMPfam: PF13855
103-160 LRR_8,Leucine rich repeat

NLTLIDLSYNYFAGEFPKAFNNCSKLQYLNLSQNSFDGKIPDDIDSLPRLQYLDLNAN

HMMSmart: SM00369
IPR003591
149-173 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPRLQYLDLNANYFSGDIPAAIGRL

Gene3D: G3DSA:3.80.10.10
217-372 no description

PSNFTKLKNLKTLHIHGSNLIGELPGTLGEMAALEELDLATNSLNGTIPNGLFLLKNLSIIYLFNNSLSGHVPQVVEALNLSIIDISGNDLTGPIPEDYGNLTKLTELALFLNGFSGAVPASIGRLPNLKQFRVFINNLSGTLPPDLGRYSELEGF

HMMSmart: SM00369
IPR003591
247-271 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MAALEELDLATNSLNGTIPNGLFLL

superfamily: SSF52047
286-592 RNI-like,LRR

GHVPQVVEALNLSIIDISGNDLTGPIPEDYGNLTKLTELALFLNGFSGAVPASIGRLPNLKQFRVFINNLSGTLPPDLGRYSELEGFEVSGNRLTGKLPDHLCYRGKLSTLVAYENNLTGELPSSLGNCTSLTEVKVSDNGLSGNIPSGLWTAPNLSQVLMSNNSLTGELPEKISQNLTRLEIRDNRFSGNIPTGVSSWNLKVFDAGNNLFNGTIPQELTALRSLITLSLDQNQLTGFLPSEIMSWESLNILNFSRNQLSGPIPARLGLLPVLTALDLSENQLSGQIPAQLGHLKLSNFNLSSNHLS

HMMSmart: SM00369
IPR003591
342-366 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLKQFRVFINNLSGTLPPDLGRY

Gene3D: G3DSA:3.80.10.10
373-602 no description

EVSGNRLTGKLPDHLCYRGKLSTLVAYENNLTGELPSSLGNCTSLTEVKVSDNGLSGNIPSGLWTAPNLSQVLMSNNSLTGELPEKISQNLTRLEIRDNRFSGNIPTGVSSWNLKVFDAGNNLFNGTIPQELTALRSLITLSLDQNQLTGFLPSEIMSWESLNILNFSRNQLSGPIPARLGLLPVLTALDLSENQLSGQIPAQLGHLKLSNFNLSSNHLSGKIPIEFENP

HMMSmart: SM00369
IPR003591
507-531 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLITLSLDQNQLTGFLPSEIMSW

HMMSmart: SM00369
IPR003591
555-579 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPVLTALDLSENQLSGQIPAQLGHL

HMMPfam: PF13516
555-577 LRR_6,Leucine Rich repeat

LPVLTALDLSENQLSGQIPAQLG

Seg: seg
579-592 seg

LKLSNFNLSSNHLS

Seg: seg
641-661 seg

LALILTFGILLSLLALSLSFF

superfamily: SSF56112
IPR011009
667-977 Protein kinase-like (PK-like)
Protein kinase-like domain

WKRNRSDFDWKLTAFQRLNFRVSKILSGLTESNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRWLHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQIL

Gene3D: G3DSA:3.30.200.20
690-783 no description

KILSGLTESNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRW

HMMSmart: SM00220
IPR002290
695-978 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LTESNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRWLHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQILL

ProfileScan: PS50011
IPR000719
695-985 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LTESNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRWLHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQILLRCGHPGV

HMMSmart: SM00219
IPR020635
695-977 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LTESNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRWLHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQIL

HMMPfam: PF00069
IPR000719
698-975 Pkinase,Ser-thr
Protein kinase, catalytic domain

SNMIGSGGSGKVYCVPVNRTGDVVAVKKIWKDKKLEEKLEKEFLAEVKILSSIRHANIVKLMCCISKDNSKLLVYEYSENRSLDRWLHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQ

PatternScan: PS00107
IPR017441
701-725 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGGSGKVYCVPVNRTGDVVAVKK

Seg: seg
724-745 seg

KKIWKDKKLEEKLEKEFLAEVK

Gene3D: G3DSA:1.10.510.10
784-976 no description

LHKRNRPSNLSRSVHHVVLDWPKRLHIAVGAAQGLHYMHHDCVPPVVHRDVKSSNILLDSDFNAKIADFGLAKMLVKQGELATMSAVAGSFGYIAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADALDKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQI

PatternScan: PS00108
IPR008271
829-841 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox