PRGDB00172534 (ppa025931m)

From PRG Wiki
Jump to: navigation, search
ppa025931m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

transmembrane receptors;ATP binding (best arabidopsis hit)

DNA Sequence

ATGGCTGCTACCAGCACGCAGCAGGATCCGTCCTCTCACCGGTGCACTTATGATGCATTCTTGAGCTTCAGGGGCACAGATACACGCAAGGGATTTACTGATCACCTTTACAGGGCTTTGGAGGTGGCAGGGATCCACACTTTTAGAGATGATGACGAAATCGAAAGAGGAGCAAATATTTCAGCAGAGCTTCAAAAAGCAATACAAGAGTCTCGAGTATCCATCATTGTCTTCTCCAAGGACTACGCTTCCTCGAGATGGTGCCTGGATGAACTAGTGACGATCATGGACCGTAGAGAAACTAATGAGCACATGGTTATGCCGATTTTCTATGATGTGGATCCATCCCATGTCAGGAACCAGACAGGAATTTTTGAACAAGCTTTTGCCAGACACCAACAGCGCTTCAACAAGGAGATGGACAAGGTGGAGAAGTGGAGAAAAGCTCTCAGAGATGTTGCAGATTTGGGAGGGATGGTTTTAGGAGATCGGTACGAGTCGCAGTTTGTCCAAGATATAGTTGAAATTATTGGAAATAAACTGGATCACACATGGAATAGGAGATTAAGAGTCGATCCCTATGTAGTTGGAATGGATTATCGTGTGAGAGGCCTAAACATGTGGTTAGAAGATGGATCAAGTGATGTTGGAGTAGCTGTAGTCTATGGGATGGGTGGAATTGGCAAGACCACCATTGCCAAGACTGCTTATAACCAGAACTACAATAAATTTCAAGGTAGCAGCTTTCTTGCAGATATTAGAGCAACTTCAAAACTTCCCAATGGTTTTGTACACTTGCAAAGGAACCTTCTTTCAGATCTCCAAAAGGGGAAAGCAAAGAAAATATACAGCTTGGATGAAGGAATAACAAAGATCAAACGGGCGATACGTTGCAAAAGAGTTCTTATTGCTCTTGATGATGTGGACAACTTGGAACAATTCAATGCAATTCTTGGAATGCGAGAATGGCTTCATCCAGGAAGTAAAATAATCATAACAACTAGACATGAACATTTGTTAAAGGCTCATGAGAATTATGCAATATTGTTTAAGGTGGAAGGGTTGCATGAGTATGAATCACTTGAGCTTTTCAGTTGGCATGCCTTTAGACAACCCCATCCTAGCGAAGGTTACATGGATCTTTCAAGACCTGTAGTGCAACACTGTGGAGGGGTTCCATTAGCTCTTCAAGTTCTAGGATCTTCTCTATTTGGTAAAGCTGCAGATGTATGGAAAAATGCATTACAGAACTTAGATGTAATTACTGAAGGAAAAATTCAAAAGATTCTCAGAATAAGCTTTGATTCTCTGCAAGATCATGACAAACGTCTGTTCCTCCATATAGCCTGTTTCTTCGTAGGAAAAGACAATGATTTTTCAACTACAGTCCTTGATGAATGTGAGTTTGCCACAAACATTGGAATGCAAAATCTGGTTGATAGATGTTTGCTGATAATTGATGGATTCAACAAGTTAACCATGCACCAATTACTTCAAGACATGGGAAGGGGAATTATTCGCGAAGAATCGCCTGAGGATCCTGGAAAACGTACTAGAGTGTGGAATAAAGATGCCTCTAATGTTTTGAGAAAATTAACTGGTACAGAAACTATTAAGGGCCTCGTGCTCAACATTCCTATGTTAATAAAAGATGAGTCTTCTAAGATAATATTCAGTGGAAGTAACAGAAAAAGATTCCATGTTGAAGATTATGATGGAAACTGTTCAAGCAGCCGACGTCGGCTTGGTTTCTTCTCCTGGCAGTCAATTACAAACTCATTTCCTGTATCAAATGAGATAGGTTTCAAAACAGAGGCATTTAGAAGGATGCACAATCTTGAACTCCTGCTGCTTGATAATGTAAAAATCAGTGGAGGCTATGAAGATTTCCCAAAAAATTTAATATGGTTGTCTTGGCGAGGATTCGCTTTAAAGTCATTACCAACCAATTTTTACTTGGAAAATCTAATTGTTCTTGACTTGCGGAACAGCAGCCTCCAACATGTTTGGAAGGGAACTAGGTTTCTTCTAAGACTGAAAATCTTAAATCTCAGTCATTCACATGGCCTTGTGACAACCCCTGACTTGTCAGGACTCCCTAACCTCGAGAGATTAATTCTTAAAGATTGCATAAATTTGAAAGAGGTGGATGAATCCATTGGAGATTTGGAGAAACTTGTTTTCTTGAATCTAAAAGATTGCAAAAATCTCATGAAGCTTCCAATAAGAATTAGTATGCTGCGATCTCTCCAGAAACTTATTCTCTCTGGTTGCCCAAATCTTGTGCTGCCTGCCAGTATGATTGTTAAAAATCAGTCAGACTCTGTACCTAGTGACATGAAGCAACTCAGTCTGTTATCTGCAGTTAAATCGTGGCAATCAATCCGATCATGGGTATTGCCAAGAAAAAATCTCCAACTTACCAGTGCAAGTTTGCCACAATTTTTAAAAAGCTTAAGTATGGCATACTGCAATCTGTCAGAAATTCCCGATGGTCTTAGTAGCCTATCCTCATTGAAGCATTTGAATCTAAGTGGAAACCCATTTTTGAGCCTAAACATGAATGGTCTTAGTAAGCTCCAGAGTCTTTTGTTGGATGGTTGCACAAACCTCGAAATGCTTGCCGAGCTCCCACCGAGTGTAGAGAGATTGCAAGCATGGGAATGTACTTCATTGAAAAGAGTACAAACTTACTTACCCAACAAGTTATCAATGGGACATGAGGTTTTGAGATGCGAGAATTTAGTTGAATTTCAAAACGTGTTCAAAACAAGACCGTTGAGAAGCTTCGACATAGAAATGATCAAAGATATCGGTCTGTTCAATTTGGAATCCATAGGAAGCACTGAAGTTGAAATGATCAACTACTTGACACGTACAACGAGGAAGGGTCCTCTCCAGGGACTGGATGAATGTGGTATATTTAGCATATTCCTTCCTGGGAGCGAGGTTCCAGATTGGTTCTGCTACAAGTCGAGCATGGGTAACTCTGAGCTGTCTATAACTATACCTCCACATCTTAATTTAAAGATCCGAGGCCTAAATGCATGTGTTGTTTATGCACAAGGTAAGGTTCTTGTTGAGGATTTGAAATGTTACTCGGTCGTTCCCTTTCTTCGCATCAGCAATGAGACCAAGGGTTTTAAGTGGACCTATTTGCCAGTCACAATAGGGTTTCCAAAAGAGAAGGAAGACATGTTATGGCTTAGTCATTGGCGATTCACAAACGATGAATTGGAGGGTGGGGAAGAAATACGTGTTTCAGTTAGAGATGAATCCGATAGTTTCTGGACAAAGGAATTTGGAATCCAGCTTGTGTACGAGCAGAATAATAATGAGGCTTCTCTGTTAGCATCTTTCATCTCCTCTTCTTCGTCAGCTATCAAGACATTTCCGCTTTCGAGCAAGCACTCAGCCATTCAGCCTTTCAGCCTTTTCAGTTTTGCACCCATTCAAATTCTTGGAGCAGAGAGAGTGAGAGAGGTGGAGAATACTGAACAGCATTCGATTTGGGATGGTCCATTTTCTTCCACAGTGTCTGAGTCGGGAATTTCATCGAACAGTTAG


Protein sequences

Name Description Sequence
ppa025931m transmembrane receptors;ATP binding (best arabidopsis hit)

MAATSTQQDPSSHRCTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNKEMDKVEKWRKALRDVADLGGMVLGDRYESQFVQDIVEIIGNKLDHTWNRRLRVDPYVVGMDYRVRGLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKTAYNQNYNKFQGSSFLADIRATSKLPNGFVHLQRNLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMREWLHPGSKIIITTRHEHLLKAHENYAILFKVEGLHEYESLELFSWHAFRQPHPSEGYMDLSRPVVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHDKRLFLHIACFFVGKDNDFSTTVLDECEFATNIGMQNLVDRCLLIIDGFNKLTMHQLLQDMGRGIIREESPEDPGKRTRVWNKDASNVLRKLTGTETIKGLVLNIPMLIKDESSKIIFSGSNRKRFHVEDYDGNCSSSRRRLGFFSWQSITNSFPVSNEIGFKTEAFRRMHNLELLLLDNVKISGGYEDFPKNLIWLSWRGFALKSLPTNFYLENLIVLDLRNSSLQHVWKGTRFLLRLKILNLSHSHGLVTTPDLSGLPNLERLILKDCINLKEVDESIGDLEKLVFLNLKDCKNLMKLPIRISMLRSLQKLILSGCPNLVLPASMIVKNQSDSVPSDMKQLSLLSAVKSWQSIRSWVLPRKNLQLTSASLPQFLKSLSMAYCNLSEIPDGLSSLSSLKHLNLSGNPFLSLNMNGLSKLQSLLLDGCTNLEMLAELPPSVERLQAWECTSLKRVQTYLPNKLSMGHEVLRCENLVEFQNVFKTRPLRSFDIEMIKDIGLFNLESIGSTEVEMINYLTRTTRKGPLQGLDECGIFSIFLPGSEVPDWFCYKSSMGNSELSITIPPHLNLKIRGLNACVVYAQGKVLVEDLKCYSVVPFLRISNETKGFKWTYLPVTIGFPKEKEDMLWLSHWRFTNDELEGGEEIRVSVRDESDSFWTKEFGIQLVYEQNNNEASLLASFISSSSSAIKTFPLSSKHSAIQPFSLFSFAPIQILGAERVREVENTEQHSIWDGPFSSTVSESGISSNS*

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-159 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

STQQDPSSHRCTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNKEMDKVEKWRKALRDVADLGGM

Gene3D: G3DSA:3.40.50.10140
13-151 no description

HRCTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNKEMDKVEKWRKALR

ProfileScan: PS50104
IPR000157
15-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNKEMDKVEKWRKALRDVADL

HMMSmart: SM00255
IPR000157
16-156 Toll
Toll/interleukin-1 receptor homology (TIR) domain

TYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNKEMDKVEKWRKALRDVADL

HMMPfam: PF01582
IPR000157
19-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNKEMDKVEKWRKALR

HMMPanther: PTHR11017
46-1022 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HTFRDDDEIERGANISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNKEMDKVEKWRKALRDVADLGGMVLGDRYESQFVQDIVEIIGNKLDHTWNRRLRVDPYVVGMDYRVRGLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKTAYNQNYNKFQGSSFLADIRATSKLPNGFVHLQRNLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMREWLHPGSKIIITTRHEHLLKAHENYAILFKVEGLHEYESLELFSWHAFRQPHPSEGYMDLSRPVVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHDKRLFLHIACFFVGKDNDFSTTVLDECEFATNIGMQNLVDRCLLIIDGFNKLTMHQLLQDMGRGIIREESPEDPGKRTRVWNKDASNVLRKLTGTETIKGLVLNIPMLIKDESSKIIFSGSNRKRFHVEDYDGNCSSSRRRLGFFSWQSITNSFPVSNEIGFKTEAFRRMHNLELLLLDNVKISGGYEDFPKNLIWLSWRGFALKSLPTNFYLENLIVLDLRNSSLQHVWKGTRFLLRLKILNLSHSHGLVTTPDLSGLPNLERLILKDCINLKEVDESIGDLEKLVFLNLKDCKNLMKLPIRISMLRSLQKLILSGCPNLVLPASMIVKNQSDSVPSDMKQLSLLSAVKSWQSIRSWVLPRKNLQLTSASLPQFLKSLSMAYCNLSEIPDGLSSLSSLKHLNLSGNPFLSLNMNGLSKLQSLLLDGCTNLEMLAELPPSVERLQAWECTSLKRVQTYLPNKLSMGHEVLRCENLVEFQNVFKTRPLRSFDIEMIKDIGLFNLESIGSTEVEMINYLTRTTRKGPLQGLDECGIFSIFLPGSEVPDWFCYKSSMGNSELSITIPPHLNLKIRGLNACVVYAQ

HMMPanther: PTHR11017:SF20
46-1022 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

HTFRDDDEIERGANISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNKEMDKVEKWRKALRDVADLGGMVLGDRYESQFVQDIVEIIGNKLDHTWNRRLRVDPYVVGMDYRVRGLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKTAYNQNYNKFQGSSFLADIRATSKLPNGFVHLQRNLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMREWLHPGSKIIITTRHEHLLKAHENYAILFKVEGLHEYESLELFSWHAFRQPHPSEGYMDLSRPVVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHDKRLFLHIACFFVGKDNDFSTTVLDECEFATNIGMQNLVDRCLLIIDGFNKLTMHQLLQDMGRGIIREESPEDPGKRTRVWNKDASNVLRKLTGTETIKGLVLNIPMLIKDESSKIIFSGSNRKRFHVEDYDGNCSSSRRRLGFFSWQSITNSFPVSNEIGFKTEAFRRMHNLELLLLDNVKISGGYEDFPKNLIWLSWRGFALKSLPTNFYLENLIVLDLRNSSLQHVWKGTRFLLRLKILNLSHSHGLVTTPDLSGLPNLERLILKDCINLKEVDESIGDLEKLVFLNLKDCKNLMKLPIRISMLRSLQKLILSGCPNLVLPASMIVKNQSDSVPSDMKQLSLLSAVKSWQSIRSWVLPRKNLQLTSASLPQFLKSLSMAYCNLSEIPDGLSSLSSLKHLNLSGNPFLSLNMNGLSKLQSLLLDGCTNLEMLAELPPSVERLQAWECTSLKRVQTYLPNKLSMGHEVLRCENLVEFQNVFKTRPLRSFDIEMIKDIGLFNLESIGSTEVEMINYLTRTTRKGPLQGLDECGIFSIFLPGSEVPDWFCYKSSMGNSELSITIPPHLNLKIRGLNACVVYAQ

superfamily: SSF52540
178-426 P-loop containing nucleoside triphosphate hydrolases

GNKLDHTWNRRLRVDPYVVGMDYRVRGLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKTAYNQNYNKFQGSSFLADIRATSKLPNGFVHLQRNLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMREWLHPGSKIIITTRHEHLLKAHENYAILFKVEGLHEYESLELFSWHAFRQPHPSEGYMDLSRPVVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKI

HMMPfam: PF00931
IPR002182
200-456 NB-ARC,NBS
NB-ARC

YRVRGLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKTAYNQNYNKFQGSSFLADIRATSKLPNGFVHLQRNLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMREWLHPGSKIIITTRHEHLLKAHENYAILFKVEGLHEYESLELFSWHAFRQPHPSEGYMDLSRPVVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHDKRLFLHIACFFVGKD

Gene3D: G3DSA:3.40.50.300
218-342 no description

VAVVYGMGGIGKTTIAKTAYNQNYNKFQGSSFLADIRATSKLPNGFVHLQRNLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMREWLHPGSKIIITTRHEHLLKA

FPrintScan: PR00364
IPR000767
218-233 DISEASERSIST
Disease resistance protein

VAVVYGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
295-309 DISEASERSIST
Disease resistance protein

AIRCKRVLIALDDVD

FPrintScan: PR00364
IPR000767
389-403 DISEASERSIST
Disease resistance protein

CGGVPLALQVLGSSL

superfamily: SSF52058
505-905 L domain-like,LRR

IIREESPEDPGKRTRVWNKDASNVLRKLTGTETIKGLVLNIPMLIKDESSKIIFSGSNRKRFHVEDYDGNCSSSRRRLGFFSWQSITNSFPVSNEIGFKTEAFRRMHNLELLLLDNVKISGGYEDFPKNLIWLSWRGFALKSLPTNFYLENLIVLDLRNSSLQHVWKGTRFLLRLKILNLSHSHGLVTTPDLSGLPNLERLILKDCINLKEVDESIGDLEKLVFLNLKDCKNLMKLPIRISMLRSLQKLILSGCPNLVLPASMIVKNQSDSVPSDMKQLSLLSAVKSWQSIRSWVLPRKNLQLTSASLPQFLKSLSMAYCNLSEIPDGLSSLSSLKHLNLSGNPFLSLNMNGLSKLQSLLLDGCTNLEMLAELPPSVERLQAWECTSLKRVQTYLPNKLSM

Gene3D: G3DSA:3.80.10.10
601-760 no description

GFKTEAFRRMHNLELLLLDNVKISGGYEDFPKNLIWLSWRGFALKSLPTNFYLENLIVLDLRNSSLQHVWKGTRFLLRLKILNLSHSHGLVTTPDLSGLPNLERLILKDCINLKEVDESIGDLEKLVFLNLKDCKNLMKLPIRISMLRSLQKLILSGCPN

FPrintScan: PR00364
IPR000767
721-737 DISEASERSIST
Disease resistance protein

GDLEKLVFLNLKDCKNL

Gene3D: G3DSA:3.80.10.10
816-892 no description

LKSLSMAYCNLSEIPDGLSSLSSLKHLNLSGNPFLSLNMNGLSKLQSLLLDGCTNLEMLAELPPSVERLQAWECTSL

HMMPfam: PF12799
816-852 LRR_4,Leucine Rich repeats (2 copies)

LKSLSMAYCNLSEIPDGLSSLSSLKHLNLSGNPFLSL

Seg: seg
833-845 seg

LSSLSSLKHLNLS

Seg: seg
1114-1128 seg

ASLLASFISSSSSAI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox