PRGDB00172541 (ppa017314m)

From PRG Wiki
Jump to: navigation, search
ppa017314m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat transmembrane protein kinase protein (best arabidopsis hit)

DNA Sequence

TTCATTAGCATAGATTGTGGCCTGCAGAAAGTTACCTATACCGAAACGACAACAAAAATTCGCTACATTTCAGACGCAAGCTTCATAGACACCGGTGAAAGTAAATCCGTGTTGAATGAGTTTAGAGATGACTATCAACAACCCTACTGGTCTCTAAGGAGCTTCCCTGAAGGAACCAGGAACTGGAACTGCTACAACATAAACGTCACAAGTGGCATCAAATATTTGATCAGAGCAAGTTTTGTTTATGGGAATTATGATGGCCAAGAAAAAGCACCTGAGTTTGAACTCCATCTTGGAGCTAACTTATGGGAGTCAATACGGTTTGAGAATGCCTCCATAGCAGCAGCACACAAAGAGCTTATACATGTCCCACTGCGAAGCTACATACATGTCTGTCTGGTGAACACAGGCTCCGGCGTTCCATTTATATCAGCAATAGAACTCAGGCCTTTACTTAATGCATCTTATCCAACACAAGTGGGGTCGTTGGCGCTTGAGATGCGATTTGATACTGGTCAAACCATTGACTCTGGATCTAGCAATGATTACCAACCACCTCCTATTGTGATGCGTACTGCTGCAACGCCAAGACGTGCGAATGCCTCCTTGGATTTCTTCTGGCTGCCTGCTGATGACAAGGCATCATACTATGTATACATGCACTTTGCAGAAGTTGAAAAGCTACAAGCAAACCAATCCAGACTGCAATACATTACTAGGAACGGGCAGGTCATTTATGAGTCATTTGCTCCTGATTACTTGTACACAAATACTATTTTTAGCCCTGCCGCTTTGAGTGGAGGACAATATAATTTTTCAATCCGTAAGGCAGAGAACTCTACCCTTCCACCCATCCTCAACGCCATTGAGATTTACACATTGAAGGAATTCTTAGAGTTAGAAACAAACCAAGAAGATAGCAATTTAGTGTTTATATTTGACGCAATCAACATCATCAAGTCAACATATAAGATTAAAAAGAACTGGCAAGGAGATCCATGTGCCCCTCAAGCTTACTTGTGGGAAGGGGTAAAGTGTAGCTATCCTCAAAATGACTCCCCAAGAATCATATCCTTGGACTTATCCTCGAGCGGATTAACAAGGGAGATAGCTCCTTCTATATCCAACCTTACAGTGATTCAGACATTGGATTTATCAAACAACAACTTGACAGGACCAATTCCTGACTTTTTGTCTCAATTGCCAGACTTAAATGTCATAAACTTGGAGAAAAACAAGCTCGCAGGCTCAGTTCCAGTAGGACTGATTGAAAGAAGGAAGAATGGTTTTCTATCATTAAGTTTGTGTGCAAATCCAAATCTATCCGGAAATGTTTCTTGCAAAAAGAAGCGCAATTTTGTTATTCCCGTAGTTGCGTCAGTCGCTGGAATCTCCATCCTCTTATTATCTGTAGCAGCTCTCTGTTGGGGCATTAAACGGAAAAGACAACCTGTGGAGGCAAGGAAACGACAGTTTACATACTCTGAGATCCTCCAGATCACCAACAATTTAAAGAGGATTCTTGGCAAAGGTGGATTTGGAACAGTTTATCATGGATGCATAGACAAAACTCAAGTAGCTGTCAAGATGCTTTCACTGTCTTCAGTTCAAGTGCTTCAACAATTTCATGCTGAGAGCAATGATGAAAATCACATAGGAGTTGTGTACGAGCACATGGAAAATGGAAACTTACAACCATATCTATCAGACCGCACTCCAGTTGTCTTCACTTGGGAAGGTAGACTTCAAATAGCTACAGATACTGCACAAGGATTGGAGTATCTGCACTATGGTTGTAGCCCACCTATGATCCACAGGGATGTGAAATCAACAAACATCTTGTTGAATGAAAATTTTCAAGCCAAACTATCTGACTTTGGCCTATCCAGAAATTTCCCTGTAGAGGATGGGACTCATATATTGACAGGTGTTGCTGGCACTCCGGGGTACCTTGCGCCCGAGTACAATATGTCAAACAGGCTAAATGAGAAAAGTGACGTTTACAGCTTTGGGGTTGTACTGTTGGAGATTATCGCAGGTCGACCTGCTTTTATAAACACACATGAAAGAATTCACATAAGTAAATGGGTTGGTTTGTTGCTTCCAAAAGGAGACATTTACAGCATTGTTGATCCAAGGTTAGAGAGAAGTTTCAATGTTAGCTCTGTCTGGAAAGCTGTGGAATTAGCAATGGCATGTGTATCTAAACACCCTATCAACAGGCCATCCATGAGCCAGGTATTGGTGGAACTAAAGGAGTGTTTGGCAACCGAACTGGCTCGAACAAAGCAGAGCGGCAATCACACTGAAATAGGAAATTCCATAAGGCAAGCACAGAGCATAATAGTAGGGCATGAACAAATTTCCATTGGCCACTTACCCATAAACAAGTGCCACAGTGTCACCCTCAACGCAATACCCAATTAG


Protein sequences

Name Description Sequence
ppa017314m Leucine-rich repeat transmembrane protein kinase protein (best arabidopsis hit)

FISIDCGLQKVTYTETTTKIRYISDASFIDTGESKSVLNEFRDDYQQPYWSLRSFPEGTRNWNCYNINVTSGIKYLIRASFVYGNYDGQEKAPEFELHLGANLWESIRFENASIAAAHKELIHVPLRSYIHVCLVNTGSGVPFISAIELRPLLNASYPTQVGSLALEMRFDTGQTIDSGSSNDYQPPPIVMRTAATPRRANASLDFFWLPADDKASYYVYMHFAEVEKLQANQSRLQYITRNGQVIYESFAPDYLYTNTIFSPAALSGGQYNFSIRKAENSTLPPILNAIEIYTLKEFLELETNQEDSNLVFIFDAINIIKSTYKIKKNWQGDPCAPQAYLWEGVKCSYPQNDSPRIISLDLSSSGLTREIAPSISNLTVIQTLDLSNNNLTGPIPDFLSQLPDLNVINLEKNKLAGSVPVGLIERRKNGFLSLSLCANPNLSGNVSCKKKRNFVIPVVASVAGISILLLSVAALCWGIKRKRQPVEARKRQFTYSEILQITNNLKRILGKGGFGTVYHGCIDKTQVAVKMLSLSSVQVLQQFHAESNDENHIGVVYEHMENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVLVELKECLATELARTKQSGNHTEIGNSIRQAQSIIVGHEQISIGHLPINKCHSVTLNAIPN*

Domains

Domain Start-End Description Sequence

HMMPfam: PF12819
IPR024788
4-175 Malectin_like,Carbohydrate-binding protein of the ER
Malectin-like carbohydrate-binding domain

IDCGLQKVTYTETTTKIRYISDASFIDTGESKSVLNEFRDDYQQPYWSLRSFPEGTRNWNCYNINVTSGIKYLIRASFVYGNYDGQEKAPEFELHLGANLWESIRFENASIAAAHKELIHVPLRSYIHVCLVNTGSGVPFISAIELRPLLNASYPTQVGSLALEMRFDTGQT

HMMPanther: PTHR24420
20-766 FAMILY NOT NAMED,FAMILY NOT NAMED

IRYISDASFIDTGESKSVLNEFRDDYQQPYWSLRSFPEGTRNWNCYNINVTSGIKYLIRASFVYGNYDGQEKAPEFELHLGANLWESIRFENASIAAAHKELIHVPLRSYIHVCLVNTGSGVPFISAIELRPLLNASYPTQVGSLALEMRFDTGQTIDSGSSNDYQPPPIVMRTAATPRRANASLDFFWLPADDKASYYVYMHFAEVEKLQANQSRLQYITRNGQVIYESFAPDYLYTNTIFSPAALSGGQYNFSIRKAENSTLPPILNAIEIYTLKEFLELETNQEDSNLVFIFDAINIIKSTYKIKKNWQGDPCAPQAYLWEGVKCSYPQNDSPRIISLDLSSSGLTREIAPSISNLTVIQTLDLSNNNLTGPIPDFLSQLPDLNVINLEKNKLAGSVPVGLIERRKNGFLSLSLCANPNLSGNVSCKKKRNFVIPVVASVAGISILLLSVAALCWGIKRKRQPVEARKRQFTYSEILQITNNLKRILGKGGFGTVYHGCIDKTQVAVKMLSLSSVQVLQQFHAESNDENHIGVVYEHMENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVLVELKECLATELARTKQS

HMMPanther: PTHR24420:SF417
20-766 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IRYISDASFIDTGESKSVLNEFRDDYQQPYWSLRSFPEGTRNWNCYNINVTSGIKYLIRASFVYGNYDGQEKAPEFELHLGANLWESIRFENASIAAAHKELIHVPLRSYIHVCLVNTGSGVPFISAIELRPLLNASYPTQVGSLALEMRFDTGQTIDSGSSNDYQPPPIVMRTAATPRRANASLDFFWLPADDKASYYVYMHFAEVEKLQANQSRLQYITRNGQVIYESFAPDYLYTNTIFSPAALSGGQYNFSIRKAENSTLPPILNAIEIYTLKEFLELETNQEDSNLVFIFDAINIIKSTYKIKKNWQGDPCAPQAYLWEGVKCSYPQNDSPRIISLDLSSSGLTREIAPSISNLTVIQTLDLSNNNLTGPIPDFLSQLPDLNVINLEKNKLAGSVPVGLIERRKNGFLSLSLCANPNLSGNVSCKKKRNFVIPVVASVAGISILLLSVAALCWGIKRKRQPVEARKRQFTYSEILQITNNLKRILGKGGFGTVYHGCIDKTQVAVKMLSLSSVQVLQQFHAESNDENHIGVVYEHMENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVLVELKECLATELARTKQS

HMMPfam: PF12819
IPR024788
176-294 Malectin_like,Carbohydrate-binding protein of the ER
Malectin-like carbohydrate-binding domain

IDSGSSNDYQPPPIVMRTAATPRRANASLDFFWLPADDKASYYVYMHFAEVEKLQANQSRLQYITRNGQVIYESFAPDYLYTNTIFSPAALSGGQYNFSIRKAENSTLPPILNAIEIYT

superfamily: SSF52058
330-429 L domain-like,LRR

WQGDPCAPQAYLWEGVKCSYPQNDSPRIISLDLSSSGLTREIAPSISNLTVIQTLDLSNNNLTGPIPDFLSQLPDLNVINLEKNKLAGSVPVGLIERRKN

Gene3D: G3DSA:3.80.10.10
340-435 no description

YLWEGVKCSYPQNDSPRIISLDLSSSGLTREIAPSISNLTVIQTLDLSNNNLTGPIPDFLSQLPDLNVINLEKNKLAGSVPVGLIERRKNGFLSLS

superfamily: SSF56112
IPR011009
480-752 Protein kinase-like (PK-like)
Protein kinase-like domain

KRKRQPVEARKRQFTYSEILQITNNLKRILGKGGFGTVYHGCIDKTQVAVKMLSLSSVQVLQQFHAESNDENHIGVVYEHMENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVLVEL

Gene3D: G3DSA:3.30.200.20
487-546 no description

EARKRQFTYSEILQITNNLKRILGKGGFGTVYHGCIDKTQVAVKMLSLSSVQVLQQFHAE

ProfileScan: PS50011
IPR000719
503-756 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NNLKRILGKGGFGTVYHGCIDKTQVAVKMLSLSSVQVLQQFHAESNDENHIGVVYEHMENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVLVELKECL

HMMSmart: SM00220
IPR002290
503-756 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NNLKRILGKGGFGTVYHGCIDKTQVAVKMLSLSSVQVLQQFHAESNDENHIGVVYEHMENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVLVELKECL

HMMSmart: SM00219
IPR020635
503-752 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

NNLKRILGKGGFGTVYHGCIDKTQVAVKMLSLSSVQVLQQFHAESNDENHIGVVYEHMENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVLVEL

PatternScan: PS00107
IPR017441
509-530 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGGFGTVYHGCIDKTQVAVK

HMMPfam: PF00069
IPR000719
538-749 Pkinase,Ser-thr
Protein kinase, catalytic domain

QVLQQFHAESNDENHIGVVYEHMENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVL

Gene3D: G3DSA:1.10.510.10
560-752 no description

MENGNLQPYLSDRTPVVFTWEGRLQIATDTAQGLEYLHYGCSPPMIHRDVKSTNILLNENFQAKLSDFGLSRNFPVEDGTHILTGVAGTPGYLAPEYNMSNRLNEKSDVYSFGVVLLEIIAGRPAFINTHERIHISKWVGLLLPKGDIYSIVDPRLERSFNVSSVWKAVELAMACVSKHPINRPSMSQVLVEL

PatternScan: PS00108
IPR008271
604-616 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

MIHRDVKSTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox