PRGDB00172545 (ppa006269m)

From PRG Wiki
Jump to: navigation, search
ppa006269m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

DNA Sequence

ATGTGTTTTAGGCTACTAGGGGTCATGCCTTTCACAGTCATCATGTCGGATTCCGGCGTGCCATCCGCTCTCGTGGACGGGCCACAAACCGGGTTCTCCATGAACAAAGACGGGGCCCGAACTGACACCCGTGAGCAAGAAGCGGTCTATGACATCATGCGGGCTACTGGTAATGATTGGGCCACTGACATTCCCGATGTGTGTCGTGGCCGGTGGCATGGAATTGAGTGCATGCCGGACAATAATGATGTCTACCACGTTGTTTCGCTCTCCTTCGGGGCGCTATCCGATGACACTGCATTCCCGACTTGTGACCCGACTCGGTCCCATATTTCACCATCCATCACTAAACTTCCCTACCTTCGGACCTTATTTTTCTACCGTTGTTTTAGTTACAATCCTCAGCCAATCCCGTCACTTTTGGGGCAATTGGGCGCCACACTACAAACTTTAGTGCTTAGGGAAAATGGGCATGTGGGTCCTATTCCTATTGAGCTGGGCAATCTCACCCGTTTAAAAGTTCTTGACCTCCACAAAAACAATCTCAACGGCTCAATTCCGGTGTGCCTGGCCCGGATGACCGGTCTAAGGTCGTTAGACCTGAGTGGGAACAAACTAACTTCAATACCCAATTTCAGCTTCCCAATTTTGAGCATTTTTGACCTGAGCCAAAACCTTCTAATGGGCTCAATTCCATCCAGCATTGGAGCCTGCCCTGGTCTTATCAAAATGGATTTGGGCCACAACCAACTCACCGGCCCGTTACCCTACTCCATTGGTACCTTGAAAAACCTAATGCTCATGGATCTAAGCTACAATCGCCTCAAGGGTCCACTTCCAATGTGGATTAGGAGTTTAATCTCACTTCAAACTTTGATCCTCAAAGGAAATCCAATGGGGCCCACACCAATTCCAAGTGATGGTTTTGATGGCATGAAGGGGTTGATGACCCTAATTTTATCTAACATGAATTTGCATGGTCCTATACCTTCATCCCTAGGCAAATTGCCAGGCCTTCGCGTGCTTCATCTTGATGGGAACAATTTCAATGGCTCAATCCCAACAAGCTTTAGAGAGCTCGAAAGTGTGAGTGAATTGAGATTGAATGATAATTGGCTCAGGGGCCCAATCCCATTTGGGAGAGAAATGGTTTGGAGGATGAGAAGGAAGCTTAGGGTTCATAACAATTCTGGGCTATGTTACAATGCCAATAGTGGGTTGGAAGATTCTGGCATTGGCCCCTGTGACACACCAAGGCCATGA


Protein sequences

Name Description Sequence
ppa006269m Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

MCFRLLGVMPFTVIMSDSGVPSALVDGPQTGFSMNKDGARTDTREQEAVYDIMRATGNDWATDIPDVCRGRWHGIECMPDNNDVYHVVSLSFGALSDDTAFPTCDPTRSHISPSITKLPYLRTLFFYRCFSYNPQPIPSLLGQLGATLQTLVLRENGHVGPIPIELGNLTRLKVLDLHKNNLNGSIPVCLARMTGLRSLDLSGNKLTSIPNFSFPILSIFDLSQNLLMGSIPSSIGACPGLIKMDLGHNQLTGPLPYSIGTLKNLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNPMGPTPIPSDGFDGMKGLMTLILSNMNLHGPIPSSLGKLPGLRVLHLDGNNFNGSIPTSFRELESVSELRLNDNWLRGPIPFGREMVWRMRRKLRVHNNSGLCYNANSGLEDSGIGPCDTPRP*


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
39-378 L domain-like,LRR

ARTDTREQEAVYDIMRATGNDWATDIPDVCRGRWHGIECMPDNNDVYHVVSLSFGALSDDTAFPTCDPTRSHISPSITKLPYLRTLFFYRCFSYNPQPIPSLLGQLGATLQTLVLRENGHVGPIPIELGNLTRLKVLDLHKNNLNGSIPVCLARMTGLRSLDLSGNKLTSIPNFSFPILSIFDLSQNLLMGSIPSSIGACPGLIKMDLGHNQLTGPLPYSIGTLKNLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNPMGPTPIPSDGFDGMKGLMTLILSNMNLHGPIPSSLGKLPGLRVLHLDGNNFNGSIPTSFRELESVSELRLNDNWLRGPIP

HMMPanther: PTHR24420
59-378 FAMILY NOT NAMED,FAMILY NOT NAMED

DWATDIPDVCRGRWHGIECMPDNNDVYHVVSLSFGALSDDTAFPTCDPTRSHISPSITKLPYLRTLFFYRCFSYNPQPIPSLLGQLGATLQTLVLRENGHVGPIPIELGNLTRLKVLDLHKNNLNGSIPVCLARMTGLRSLDLSGNKLTSIPNFSFPILSIFDLSQNLLMGSIPSSIGACPGLIKMDLGHNQLTGPLPYSIGTLKNLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNPMGPTPIPSDGFDGMKGLMTLILSNMNLHGPIPSSLGKLPGLRVLHLDGNNFNGSIPTSFRELESVSELRLNDNWLRGPIP

Gene3D: G3DSA:3.80.10.10
62-299 no description

TDIPDVCRGRWHGIECMPDNNDVYHVVSLSFGALSDDTAFPTCDPTRSHISPSITKLPYLRTLFFYRCFSYNPQPIPSLLGQLGATLQTLVLRENGHVGPIPIELGNLTRLKVLDLHKNNLNGSIPVCLARMTGLRSLDLSGNKLTSIPNFSFPILSIFDLSQNLLMGSIPSSIGACPGLIKMDLGHNQLTGPLPYSIGTLKNLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNPM

Seg: seg
140-153 seg

LLGQLGATLQTLVL

HMMSmart: SM00369
IPR003591
169-192 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTRLKVLDLHKNNLNGSIPVCLAR

HMMPfam: PF12799
170-212 LRR_4,Leucine Rich repeats (2 copies)

TRLKVLDLHKNNLNGSIPVCLARMTGLRSLDLSGNKLTSIPNF

ProfileScan: PS51450
IPR001611
171-194 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLKVLDLHKNNLNGSIPVCLARMT

HMMSmart: SM00369
IPR003591
193-216 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTGLRSLDLSGNKLTSIPNFSFPI

ProfileScan: PS51450
IPR001611
195-216 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRSLDLSGNKLTSIPNFSFPI

FPrintScan: PR00019
196-209 LEURICHRPT,Leucine-rich repeat signature

LRSLDLSGNKLTSI

HMMPfam: PF13855
239-298 LRR_8,Leucine rich repeat

PGLIKMDLGHNQLTGPLPYSIGTLKNLMLMDLSYNRLKGPLPMWIRSLISLQTLILKGNP

FPrintScan: PR00019
262-275 LEURICHRPT,Leucine-rich repeat signature

LKNLMLMDLSYNRL

HMMSmart: SM00369
IPR003591
286-311 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LISLQTLILKGNPMGPTPIPSDGFDG

Gene3D: G3DSA:3.80.10.10
306-379 no description

SDGFDGMKGLMTLILSNMNLHGPIPSSLGKLPGLRVLHLDGNNFNGSIPTSFRELESVSELRLNDNWLRGPIPF

HMMPfam: PF13855
314-371 LRR_8,Leucine rich repeat

GLMTLILSNMNLHGPIPSSLGKLPGLRVLHLDGNNFNGSIPTSFRELESVSELRLNDN

HMMSmart: SM00369
IPR003591
336-359 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPGLRVLHLDGNNFNGSIPTSFRE

ProfileScan: PS51450
IPR001611
338-360 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRVLHLDGNNFNGSIPTSFREL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox