PRGDB00172546 (ppa002709m)

From PRG Wiki
Jump to: navigation, search
ppa002709m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

mitogen-activated protein kinase kinase kinase 3 (best arabidopsis hit)

DNA Sequence

ATGCCTGCTTGGTGGGGAAGAAAATCAAGCAAGAGCAAAGAAGAGCAAGAGAAGACACTTCAACACAAAAACCCATACTCGAACCGCAACAACAACAATTTCATCATCAAATCTTCGATCAATAGCGATATTAAGAAGAAAGAGAAAGACGTTAGGCCCAAGAGCTTCGACGAACAAATAACTCGTGGGTCACCGAGAGCGAGCAAGGAGCTTGTGCGTGCTGGTGTTTCTGCTTCTGGGTTTTCGGGTTTCGACTCCGATGGATGCGAGAGGAAGCAGGGGCATCCCCTGCCTCGGCCGTCGGTGTCGTCGGCGCAGGGCTTGGGAAATGATCAGGTGCTTGGCTTGGGATCTGGCTCCGCCTCAATTTCAAGCGTCAGCTCCTCTGGGTCCTCCGACGACCAACCGATTGCGCATGACAGCCATGCTCAATTAGGTGCTTCCAGTTACAGAGCTAATGGTGATCCCAAGTACAACATGATGCCTAGAAGCCCCGGTCCTGGGTCTAAGGGGCCAACTAGCCCGACATCTCCTCTTCACCCGCTGTTTTGTGCCATAAGTTTGGAGTCTCCAACGGGAAAGCAAGAAGACGGGAAGAGTGTATGTCATCCACTTCCTCTCCCTCCAGGTTCTCCAACTAGCCCTTCTGCCTTGCCCAGCAGTAGAACTAGTGTCGCCATTGAGAACACAACTTGTGCACTATCAAAGTGGAAGAAGGGAAAGCTTCTAGGAAGGGGGACTTTTGGCCATGTTTATGTCGGATTTAATAGTGAAAGCGGGCAAATGTGTGCAATAAAAGAAGTTAGGCTTGTCTCTGATGATCGGACATCAAAAGAATGTCTTAAGCAACTGAACCAGGAGATAAATTTGCTTAGTCGGCTCTCACATCCAAACATTGTTCAATATCATGGAAGTGAATTGGGGGAAGACGCACTCTCTGTTTATTTGGAATATGTGTCTGGTGGCTCAATTCATAAATTACTTCAAGAATATGGTCCTTTTAAGGAACCTGTGATTCAAAATTATACCAGACAGATCATATCTGGGCTTGCCTACTTACATGGAAGAAATACGGTTCATAGGGACATTAAAGGGGCAAACATATTAGTGGGTCCTAATGGTGAAATCAAGTTGGCAGACTTTGGCATGGCAAAACATATTACAAATTGTGCTTCAATGCTTTCATTCAAAGGAAGTCCTTATTGGATGGCCCCCGAGGTTGTAATGAATATAAACGGCTATAGTCTTGCAGTGGATATATGGAGCTTGGGATGTACAATTCTTGAAATGGCAACTTCTAAACCTCCTTGGAGCCAGTATGAAGGGGTGGCAGCAATTTTTAAAATTGGAAACAGCAAAGATATTCCAGAGATTCCGGATCATCTTTCCAAAGATGCAAAAAGTTTTGTGAGGCTATGCTTGCAACGGAACCCATCAGAGCGTCCCGCAGCGTCTCAACTGCTAGACCACCCTTTCATTAGAGAGCAAACGTCTACAAGAATTTCTAACACCAAGTTAACCAAGGATGCCTTCCCGTATACTTTTCACGGAAGCAGGACACCGCCAATATTGGAGCTACATTCCAACAGAACAAGCATCACCTTGAGTGATGCAGATCACACAGCAAAGCCCACAGCCGCGACTTCAAGAGCTGTGCGGAGCCCCAGAGAGAATATAAGGATGATTACATCTTTGCCTGTATCCCCCTGTTCAAGCCCCTTACGACAATATGGACCGACACACAAGAGCTGTTTTCTTTCTCCTCCTCACCCAACTTATGCCATGATGGGACAGAGTAGTTATAATTTGAGTGACTTGTCGTATAATACACTAAGTCCAAATACATCGTACACTCTTGATCCTTGGCAGGACACAAGTATACTTAAAGCCCAAACGCCCGGAGGTTCACCAAGAACACGACCCATTTGA


Protein sequences

Name Description Sequence
ppa002709m mitogen-activated protein kinase kinase kinase 3 (best arabidopsis hit)

MPAWWGRKSSKSKEEQEKTLQHKNPYSNRNNNNFIIKSSINSDIKKKEKDVRPKSFDEQITRGSPRASKELVRAGVSASGFSGFDSDGCERKQGHPLPRPSVSSAQGLGNDQVLGLGSGSASISSVSSSGSSDDQPIAHDSHAQLGASSYRANGDPKYNMMPRSPGPGSKGPTSPTSPLHPLFCAISLESPTGKQEDGKSVCHPLPLPPGSPTSPSALPSSRTSVAIENTTCALSKWKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFKEPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFIREQTSTRISNTKLTKDAFPYTFHGSRTPPILELHSNRTSITLSDADHTAKPTAATSRAVRSPRENIRMITSLPVSPCSSPLRQYGPTHKSCFLSPPHPTYAMMGQSSYNLSDLSYNTLSPNTSYTLDPWQDTSILKAQTPGGSPRTRPI*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361
1-605 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

MPAWWGRKSSKSKEEQEKTLQHKNPYSNRNNNNFIIKSSINSDIKKKEKDVRPKSFDEQITRGSPRASKELVRAGVSASGFSGFDSDGCERKQGHPLPRPSVSSAQGLGNDQVLGLGSGSASISSVSSSGSSDDQPIAHDSHAQLGASSYRANGDPKYNMMPRSPGPGSKGPTSPTSPLHPLFCAISLESPTGKQEDGKSVCHPLPLPPGSPTSPSALPSSRTSVAIENTTCALSKWKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFKEPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFIREQTSTRISNTKLTKDAFPYTFHGSRTPPILELHSNRTSITLSDADHTAKPTAATSRAVRSPRENIRMITSLPVSPCSSPLRQYGPTHKSCFLSPPHPTYAMMGQSSYNLSD

HMMPanther: PTHR24361:SF64
1-605 SUBFAMILY NOT NAMED

MPAWWGRKSSKSKEEQEKTLQHKNPYSNRNNNNFIIKSSINSDIKKKEKDVRPKSFDEQITRGSPRASKELVRAGVSASGFSGFDSDGCERKQGHPLPRPSVSSAQGLGNDQVLGLGSGSASISSVSSSGSSDDQPIAHDSHAQLGASSYRANGDPKYNMMPRSPGPGSKGPTSPTSPLHPLFCAISLESPTGKQEDGKSVCHPLPLPPGSPTSPSALPSSRTSVAIENTTCALSKWKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFKEPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFIREQTSTRISNTKLTKDAFPYTFHGSRTPPILELHSNRTSITLSDADHTAKPTAATSRAVRSPRENIRMITSLPVSPCSSPLRQYGPTHKSCFLSPPHPTYAMMGQSSYNLSD

Seg: seg
8-18 seg

KSSKSKEEQEK

Seg: seg
23-49 seg

KNPYSNRNNNNFIIKSSINSDIKKKEK

Seg: seg
74-88 seg

AGVSASGFSGFDSDG

Seg: seg
115-132 seg

GLGSGSASISSVSSSGSS

Seg: seg
162-178 seg

PRSPGPGSKGPTSPTSP

Seg: seg
204-221 seg

PLPLPPGSPTSPSALPSS

superfamily: SSF56112
IPR011009
219-553 Protein kinase-like (PK-like)
Protein kinase-like domain

PSSRTSVAIENTTCALSKWKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFKEPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFIREQTSTRISNTKLTKDAFPYTFHGSRTPPILELHSNRTSITLSDADHTAKPTAATSRAVR

Gene3D: G3DSA:3.30.200.20
221-335 no description

SRTSVAIENTTCALSKWKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFK

HMMSmart: SM00220
IPR002290
237-493 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

WKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFKEPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFI

HMMSmart: SM00219
IPR020635
237-493 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

WKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFKEPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFI

ProfileScan: PS50011
IPR000719
237-493 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFKEPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFI

HMMPfam: PF00069
IPR000719
237-493 Pkinase,Ser-thr
Protein kinase, catalytic domain

WKKGKLLGRGTFGHVYVGFNSESGQMCAIKEVRLVSDDRTSKECLKQLNQEINLLSRLSHPNIVQYHGSELGEDALSVYLEYVSGGSIHKLLQEYGPFKEPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFI

PatternScan: PS00107
IPR017441
243-266 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGTFGHVYVGFNSESGQMCAIK

Gene3D: G3DSA:1.10.510.10
336-507 no description

EPVIQNYTRQIISGLAYLHGRNTVHRDIKGANILVGPNGEIKLADFGMAKHITNCASMLSFKGSPYWMAPEVVMNINGYSLAVDIWSLGCTILEMATSKPPWSQYEGVAAIFKIGNSKDIPEIPDHLSKDAKSFVRLCLQRNPSERPAASQLLDHPFIREQTSTRISNTKLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox