PRGDB00172547 (ppa024298m)

From PRG Wiki
Jump to: navigation, search
ppa024298m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGAGTTTCACAGGCACCATTCCACCACACTTAGGCAACCTCTCATTCCTTGTTGCACTAAGCTTCAAAAATAACAGCTTCCATGGTAGTTTGCCCCATGAATTGTCTTATTTGCGTCGCCTGAAGTTGATTAGCTTCAGATTCAACAATTTTATGGGATCCATTCCATCGTGGTTTGGGTCCTTCCCCAAACTTCAAAGCTTCGATTTGTATGGCAATCAGTTTTCAGGTACCATACCTTCGACTATCTTCAACTTGTCTACATTGCAAGACATAAATCTAAGCGCTAACAAACTATCAGGTACGTGTGCCAACAAGGTATCTACACTATTGTCATTATGCACTATACCAGACGAGATCGGTGATCTTCCAAATTTAGAGTTTTTGTCATTAGGAGTTAACAATCTCAATGGCCTCATCCCGTCCTCAGTCTTCAATATCTCCACAATGATAAAACTCTCACTTTCTTTTACTCAGCTATCAGGTAGCCTCCCAGCAAACATAGGCCTTGGGCTTCCAAACCTACAAGTCCTTTATATAGGAGCAACTGACCTCAGCGGAGTAATCCCCAACCTCTCCAGTGCTTCTATGCTCACGGCGCTAGACTTGGGCGAAAACTCATTTACAGGGTTTATTCCAACCACGCTATGTGCCTTGACAAACCTTAAGTTACTTAGGTTATCAAAGAATAATTTGGCGATTGATACTTCGACTCCAGAAGCAACCACTCTCTCTTGTTTGGCTAATCTTAGAAGTTTAACAAAACTAAGCTTGGACGCTAATCCGTTAAATGCCACACTTGATGATTTCTTTTCGAATTTCTCTACATCGACGCTTCAACATATTAGTTTAAGAAACTGCAGCATGAGGGGTAACATTCCCATTGGTATTGGCAACTTAAGCAGCTTGATATCCTTAGACCTCGAAAACAATCAATTGAGTGGATCAATTCCAACTTCATTAGGAAGACTTGGAAATCTCCAAGGTATGAACTTGAATTACAACAAATTGCAAGGTTACATCCCATATCAACTTTGTCAACTGTATAACCTCGTTAACTTACAGTTGGCTAGTAATCAGCTCTCTGGTTCTATACCTTCATGCTTGGGTAATCTAGCCGCATCTCTAAGATATCTATCACTAGGGTCCAATTTGTTGAGTTCCACAATACCATCTACTTTTTGGAGACTTGCCTATATCTTACAAGTAAACTTATCATCCAATTCTCTAATTGGACCTCTCTCACAAGATATTGGAAACTTGAAAGTTGTCGTAGAGGTAGATTTATCAAATAACAATTTATCTGGAGAAATTCCAACGGGTGGACCATTCCAAAACTTCTCTGCTCAATCATTTGTCTCAAACAGCGCATTCTGTGGTGCACCCCGATTTCATGTTCCACCATGCAAAAATACTACACTTGAACCAAATTGGAAGAAAGCTAAATATATCATCCCAGGGATCATATCAGTAATTCTACTAGTGGCCTCCATATCTATATTTGTACTACGCAGGAAAAGAAATGTGCAAGTTGCAGGAGAGGCTACCTCCTGTTGCAGTGAACTTGATTTCAAAGCCTTGGTACTGAACTACATGCCTAATGGGAGCCTGGACAAGTGGTTATATTCTCAAAACTATTCTTTGAATATCTTACAGAGGTTGAACATAATGATAGACGTTGCGGTGGCAGTGGAATACCTACACTATGGTTATTCAATACCTATTGTGCACTGTGACATGAAGCCCAGCAATATACTACTAGATGATGATATGGTTGCACACGTTGCTGATTTTGGAATTGCAAAACTCTTGGGTGGAGGAGATTCTATTACCCAAACCATGACTCTAGCCACTGTTGGGTATATGGCTCCAGAGTATGGATTGGAAGGAATGGTTTCAACAAGAGGGGATGTGTACAGTTTCGGAATTGTAGTGATGGAAACATTCACAAGAAGGAAGCCAATAGATGAGATGTTCGATGGGGAAATGAATATAAAGCAATGGATTGCAAACTCACTAGTATTACCAGATGCAAAGATAGATGAAGTTGTGGATGCCAATTTGCTTGGGATTGAGACAGAGCAGGAAGATGATGATCATGTGAGGAAGAGGGATTGCATATCAGCCATTATGAGATTAGCTCTTACTTGCTGTGCAGAATCGGCAGAAGAGAGGATAAGTATGAAAGAAGCTGTAGCCACACTCAACAAAATCAAGACAAAGTTTTTGAAGGACACCACTGCAGGAAGAGGTGTGCTGTTAAACCGTCCTCTTGTTCAGCAACCCTTCAAATAA


Protein sequences

Name Description Sequence
ppa024298m Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

MSFTGTIPPHLGNLSFLVALSFKNNSFHGSLPHELSYLRRLKLISFRFNNFMGSIPSWFGSFPKLQSFDLYGNQFSGTIPSTIFNLSTLQDINLSANKLSGTCANKVSTLLSLCTIPDEIGDLPNLEFLSLGVNNLNGLIPSSVFNISTMIKLSLSFTQLSGSLPANIGLGLPNLQVLYIGATDLSGVIPNLSSASMLTALDLGENSFTGFIPTTLCALTNLKLLRLSKNNLAIDTSTPEATTLSCLANLRSLTKLSLDANPLNATLDDFFSNFSTSTLQHISLRNCSMRGNIPIGIGNLSSLISLDLENNQLSGSIPTSLGRLGNLQGMNLNYNKLQGYIPYQLCQLYNLVNLQLASNQLSGSIPSCLGNLAASLRYLSLGSNLLSSTIPSTFWRLAYILQVNLSSNSLIGPLSQDIGNLKVVVEVDLSNNNLSGEIPTGGPFQNFSAQSFVSNSAFCGAPRFHVPPCKNTTLEPNWKKAKYIIPGIISVILLVASISIFVLRRKRNVQVAGEATSCCSELDFKALVLNYMPNGSLDKWLYSQNYSLNILQRLNIMIDVAVAVEYLHYGYSIPIVHCDMKPSNILLDDDMVAHVADFGIAKLLGGGDSITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETFTRRKPIDEMFDGEMNIKQWIANSLVLPDAKIDEVVDANLLGIETEQEDDDHVRKRDCISAIMRLALTCCAESAEERISMKEAVATLNKIKTKFLKDTTAGRGVLLNRPLVQQPFK*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-738 FAMILY NOT NAMED,FAMILY NOT NAMED

MSFTGTIPPHLGNLSFLVALSFKNNSFHGSLPHELSYLRRLKLISFRFNNFMGSIPSWFGSFPKLQSFDLYGNQFSGTIPSTIFNLSTLQDINLSANKLSGTCANKVSTLLSLCTIPDEIGDLPNLEFLSLGVNNLNGLIPSSVFNISTMIKLSLSFTQLSGSLPANIGLGLPNLQVLYIGATDLSGVIPNLSSASMLTALDLGENSFTGFIPTTLCALTNLKLLRLSKNNLAIDTSTPEATTLSCLANLRSLTKLSLDANPLNATLDDFFSNFSTSTLQHISLRNCSMRGNIPIGIGNLSSLISLDLENNQLSGSIPTSLGRLGNLQGMNLNYNKLQGYIPYQLCQLYNLVNLQLASNQLSGSIPSCLGNLAASLRYLSLGSNLLSSTIPSTFWRLAYILQVNLSSNSLIGPLSQDIGNLKVVVEVDLSNNNLSGEIPTGGPFQNFSAQSFVSNSAFCGAPRFHVPPCKNTTLEPNWKKAKYIIPGIISVILLVASISIFVLRRKRNVQVAGEATSCCSELDFKALVLNYMPNGSLDKWLYSQNYSLNILQRLNIMIDVAVAVEYLHYGYSIPIVHCDMKPSNILLDDDMVAHVADFGIAKLLGGGDSITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETFTRRKPIDEMFDGEMNIKQWIANSLVLPDAKIDEVVDANLLGIETEQEDDDHVRKRDCISAIMRLALTCCAESAEERISMKEAVATLNKI

superfamily: SSF52058
1-113 L domain-like,LRR

MSFTGTIPPHLGNLSFLVALSFKNNSFHGSLPHELSYLRRLKLISFRFNNFMGSIPSWFGSFPKLQSFDLYGNQFSGTIPSTIFNLSTLQDINLSANKLSGTCANKVSTLLSL

Gene3D: G3DSA:3.80.10.10
3-113 no description

FTGTIPPHLGNLSFLVALSFKNNSFHGSLPHELSYLRRLKLISFRFNNFMGSIPSWFGSFPKLQSFDLYGNQFSGTIPSTIFNLSTLQDINLSANKLSGTCANKVSTLLSL

HMMSmart: SM00369
IPR003591
62-86 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FPKLQSFDLYGNQFSGTIPSTIFNL

HMMPfam: PF00560
IPR001611
64-84 LRR_1
Leucine-rich repeat

KLQSFDLYGNQFSGTIPSTIF

superfamily: SSF52058
116-456 L domain-like,LRR

IPDEIGDLPNLEFLSLGVNNLNGLIPSSVFNISTMIKLSLSFTQLSGSLPANIGLGLPNLQVLYIGATDLSGVIPNLSSASMLTALDLGENSFTGFIPTTLCALTNLKLLRLSKNNLAIDTSTPEATTLSCLANLRSLTKLSLDANPLNATLDDFFSNFSTSTLQHISLRNCSMRGNIPIGIGNLSSLISLDLENNQLSGSIPTSLGRLGNLQGMNLNYNKLQGYIPYQLCQLYNLVNLQLASNQLSGSIPSCLGNLAASLRYLSLGSNLLSSTIPSTFWRLAYILQVNLSSNSLIGPLSQDIGNLKVVVEVDLSNNNLSGEIPTGGPFQNFSAQSFVSNS

Gene3D: G3DSA:3.80.10.10
116-233 no description

IPDEIGDLPNLEFLSLGVNNLNGLIPSSVFNISTMIKLSLSFTQLSGSLPANIGLGLPNLQVLYIGATDLSGVIPNLSSASMLTALDLGENSFTGFIPTTLCALTNLKLLRLSKNNLA

HMMSmart: SM00369
IPR003591
123-147 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLEFLSLGVNNLNGLIPSSVFNI

HMMSmart: SM00369
IPR003591
172-195 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLQVLYIGATDLSGVIPNLSSA

HMMSmart: SM00369
IPR003591
219-245 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLKLLRLSKNNLAIDTSTPEATTLS

Seg: seg
219-232 seg

LTNLKLLRLSKNNL

Gene3D: G3DSA:3.80.10.10
245-441 no description

SCLANLRSLTKLSLDANPLNATLDDFFSNFSTSTLQHISLRNCSMRGNIPIGIGNLSSLISLDLENNQLSGSIPTSLGRLGNLQGMNLNYNKLQGYIPYQLCQLYNLVNLQLASNQLSGSIPSCLGNLAASLRYLSLGSNLLSSTIPSTFWRLAYILQVNLSSNSLIGPLSQDIGNLKVVVEVDLSNNNLSGEIPTG

HMMSmart: SM00369
IPR003591
250-273 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLTKLSLDANPLNATLDDFFSN

HMMSmart: SM00369
IPR003591
300-324 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLISLDLENNQLSGSIPTSLGRL

HMMPfam: PF13855
301-361 LRR_8,Leucine rich repeat

SSLISLDLENNQLSGSIPTSLGRLGNLQGMNLNYNKLQGYIPYQLCQLYNLVNLQLASNQL

HMMSmart: SM00369
IPR003591
348-372 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LYNLVNLQLASNQLSGSIPSCLGNL

HMMSmart: SM00369
IPR003591
374-397 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

ASLRYLSLGSNLLSSTIPSTFWRL

HMMPfam: PF00560
IPR001611
375-397 LRR_1
Leucine-rich repeat

SLRYLSLGSNLLSSTIPSTFWRL

ProfileScan: PS50011
IPR000719
447-743 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSAQSFVSNSAFCGAPRFHVPPCKNTTLEPNWKKAKYIIPGIISVILLVASISIFVLRRKRNVQVAGEATSCCSELDFKALVLNYMPNGSLDKWLYSQNYSLNILQRLNIMIDVAVAVEYLHYGYSIPIVHCDMKPSNILLDDDMVAHVADFGIAKLLGGGDSITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETFTRRKPIDEMFDGEMNIKQWIANSLVLPDAKIDEVVDANLLGIETEQEDDDHVRKRDCISAIMRLALTCCAESAEERISMKEAVATLNKIKTKFL

HMMSmart: SM00220
IPR002290
478-743 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

WKKAKYIIPGIISVILLVASISIFVLRRKRNVQVAGEATSCCSELDFKALVLNYMPNGSLDKWLYSQNYSLNILQRLNIMIDVAVAVEYLHYGYSIPIVHCDMKPSNILLDDDMVAHVADFGIAKLLGGGDSITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETFTRRKPIDEMFDGEMNIKQWIANSLVLPDAKIDEVVDANLLGIETEQEDDDHVRKRDCISAIMRLALTCCAESAEERISMKEAVATLNKIKTKFL

Seg: seg
488-503 seg

IISVILLVASISIFVL

HMMSmart: SM00219
IPR020635
494-735 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LVASISIFVLRRKRNVQVAGEATSCCSELDFKALVLNYMPNGSLDKWLYSQNYSLNILQRLNIMIDVAVAVEYLHYGYSIPIVHCDMKPSNILLDDDMVAHVADFGIAKLLGGGDSITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETFTRRKPIDEMFDGEMNIKQWIANSLVLPDAKIDEVVDANLLGIETEQEDDDHVRKRDCISAIMRLALTCCAESAEERISMKEAVATL

superfamily: SSF56112
IPR011009
518-735 Protein kinase-like (PK-like)
Protein kinase-like domain

CCSELDFKALVLNYMPNGSLDKWLYSQNYSLNILQRLNIMIDVAVAVEYLHYGYSIPIVHCDMKPSNILLDDDMVAHVADFGIAKLLGGGDSITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETFTRRKPIDEMFDGEMNIKQWIANSLVLPDAKIDEVVDANLLGIETEQEDDDHVRKRDCISAIMRLALTCCAESAEERISMKEAVATL

Gene3D: G3DSA:1.10.510.10
518-733 no description

CCSELDFKALVLNYMPNGSLDKWLYSQNYSLNILQRLNIMIDVAVAVEYLHYGYSIPIVHCDMKPSNILLDDDMVAHVADFGIAKLLGGGDSITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETFTRRKPIDEMFDGEMNIKQWIANSLVLPDAKIDEVVDANLLGIETEQEDDDHVRKRDCISAIMRLALTCCAESAEERISMKEAVA

HMMPfam: PF00069
IPR000719
526-733 Pkinase,Ser-thr
Protein kinase, catalytic domain

ALVLNYMPNGSLDKWLYSQNYSLNILQRLNIMIDVAVAVEYLHYGYSIPIVHCDMKPSNILLDDDMVAHVADFGIAKLLGGGDSITQTMTLATVGYMAPEYGLEGMVSTRGDVYSFGIVVMETFTRRKPIDEMFDGEMNIKQWIANSLVLPDAKIDEVVDANLLGIETEQEDDDHVRKRDCISAIMRLALTCCAESAEERISMKEAVA

PatternScan: PS00108
IPR008271
575-587 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDMKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox