PRGDB00172548 (ppa017049m)

From PRG Wiki
Jump to: navigation, search
ppa017049m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

DNA Sequence

ATGTCAGGAACAGGAACCTCTGCCTCCTCCTCCTCCTCCTCATCAGCTTCGGTAATTTTCTTGTATGCTGCTGCTGCGTTCTGCTGCATATTTGGGTTTGGTGGTATTGGCATAGCAGAAGCTCAAGCTCCTACTTCTCAACCTCAAGCCACCACCGATCCATCTGAAGTGAGAGCTTTAAACTCAATCTTTGCGCAATGGAAGATTTCGGCCAATCAACGGCAATGGAACACCACCGGCGACCCTTGCAGTGGAGCGGCCATAGACTCCACCGCCTTCGGCGACGAGGATTACAACCCCTTCATCAAATGTGACTGTTCTTTCGACAGCAACTCCACTTGCCACATTACCCAACTGAAAGTTTATTCTTTGGATGTTGTTGGTGTAATCCCAGTTGAGCTCTGGACTTTGACTTTCCTCTTCGATCTGAATTTGGCTCAGAATTACTTGACAGGACCTCTCTCTGCATCCATTGGAAATCTGACTAGCATGCAATACTTGACCCTTGGAATTAATGCATTATCAGGCGAGCTACCGAAGGAACTTGGAAATCTCACTGATTTGAGAACATTCGCTTTTGGAGCAAACAACTTTTCTGGTCCTCTGCCATCTGAGCTAGGGAGTTTAACAAAACTAAAAGAGATTTACTTTGATAGTTCTGGAGTTAGTGGCGAAATTCCATCAACATTTGCTAATCTGCAAAACTTGGAAATAGTTTGGGCATCGGACACTGAACTGACTGGCAGGATACCTGACTTCATAGGAAATTGGTCAAAGCTTTCTGTCTTGAGGTTTCAAGGAAACTCTTTTGAAGGTCCCATACCAGTTACATTTTCCAAGCTGACTTCTCTGACAGAGCTGAGAATTAGTGATTTATCCAATGTCAACGGGAGCTCATCTCTTGGATTTATTAAGGATATGAAGTCTCTCAGTATTTTAGTGCTGAGGAATAACAATATTTCTGATTCAATTCCTTCCAACATTGGAGAATACCAAAGTTTGTCTCAGCTGGATTTGAGCTTCAACAATTTAACTGGACAGATACCAGACTCGCTGTTTAACTTGAGTTCGCTCTCTATTCTGTTTCTTGGAAACAATAAGTTGAACGGTACCCTGCCTGAATCTAAAAGTTCGTCTCTTCTCAACATAGATTTATCTTACAATAATCTACTGGGGAGCTTTCCTTCATGGGTCAACGAACAAAAGTTACAGCTTAATTTAGTCGCCAACAACTTCAGCATAGAAAGTTCAAACAGCAGTGCTCTACCTTCAGGGTTGAATTGCCTTCAACAGAACTTTCCTTGCAATCGTGGCACTGGACTCTATTATAACTTGGGGATTAAATGTGGTGGTCCTCAGATTACATCTTCCAATGGCATTGTGTATGAGAATGAAAATCAGACCCTTGGTCCAGCTACATATTTTGTGACTGGCACAAACAAATGGGGAGTTAGCAATGTTGGATATTTCACTTCGACCAACAATCCTCAATATACAAGTTTCTCTTTATCTCAATTCAAAAATACTTTAGATTCTGAGATATTCCAGACTGCAAGGCTTTCAGCTTCATCACTTAGATACTATGGCTTGGGGCTTGAGAACGGTAACTACACTGTGACCCTTCAATTTGCAGAAACAGCTATCCTAGATTCTACTACATGGAAAAGTCTTGGAAAACGTGTATTTGATATTTATATCCAGGGCAACCTGTTTCTAAAGGATTTTGATATACGGAAGGAGGCAGGTGCATCTTTCCAAGCCGTGCAGAAGGAGTACGCGGCTCAGGTTTCAGAGAACTACCTAGAAATTCATCTCTTTTGGGCTGGAAAGGGGACTTGCTGCATACCTGGGCAGGGTACATATGGACCTGTTATTTCAGCCATCAGTGCTACACCAGATTTCATACCTACTGTCAGTAACAACCCCACAACTAGTAAGAAGAATAGGACTGGGCTGATTGTAGGAATCATTGTTGGTGGTGGAGTTTTAATTCTGATGGTGGCCATTTTCTATATTTTCCAAAGAAGAAAAAGGACTAACACAATGGATGATGAAGAGCTGTTAGGGATAGATATCGGGCCACTCACTTTCAGCTTTTCGGAACTGAAGTCAGCTACAAATGACTTTAATCCAGATAATAAGCTTGGGGAGGGAGGATTTGGACCTGTCTATAAGGGAACGCTTAATGATGGAAGAGTAATTGCTGTGAAGCAATTGTCTGCAGCATCCCATCAAGGAAAGAGCCAGTTTGTAACTGAGATTGCCACTATCTCTGCTGTGCAACACAATAACCTAGTGGATTTGTATGGATTCTGCGTTGAGGGAGATAAGCGACTCCTTGTTTATGAGTATCTAGAGAACAACAGTCTTGATCAAGCATTATTTGGAAAAAGAAGTTTGAATCTTGATTGGTCAACACGTTTTGATATATGCTTGGGCGTCGCAAGAGGTTTAACTTATCTTCATGAGGAATCAAGGCTTCGGATTGTGCACAGAGATGTGAAGGCCAGTAATATCCTGCTTGACTCTAATCTCATCCCCAAAATATCAGATTTTGGTTTAGCCAAGCTTTATGATGATAAAAAGACCCACATCAGTACCGGGGTTGCAGGAACAATTGGGTATCTTGCCCCGGAATATGCCATGCGTGGACACCTTACAGAGAAGAGTGACGTCTTTTCGTTTGGTGTTGTGGCCCTAGAAACTGTCAGTGGTAGGCCAAATTCTGACCCGAGTTTGGATGAAGAAAAGATTTATCTTCTTGAATGGGCTTGGTACTTGCATGAAACCAAACGTGAAGTTGAACTAGTGGACTCCAGATTATCCGAATTCAACGAGGAAGAAGTAAAACGAGTAATTGCTATAGCATTTTTGTGCACTCAAGCATCACCATTGCTACGACCATCGATGTCCCGTGTGGTGGGAATGCTTTCAGGAGATATCGAAGTGGCGACTGTAACCTCAAAGCCTGGTTACTTGACTGACTGGAAATTTGATGACATAAGTGGTATAAACAGTATGACTATCGATATGTCAACTAAAGGAACTGATTCTAGCGTTTACAACTCATCGGCAAGTACAACCGTGGTGGGGGATACAAGTCAATTACCTGCAAAGGCCACTCAACCCATAATTTACAATACTGTTCGCAATGGCAGGTGA


Protein sequences

Name Description Sequence
ppa017049m Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

MSGTGTSASSSSSSSASVIFLYAAAAFCCIFGFGGIGIAEAQAPTSQPQATTDPSEVRALNSIFAQWKISANQRQWNTTGDPCSGAAIDSTAFGDEDYNPFIKCDCSFDSNSTCHITQLKVYSLDVVGVIPVELWTLTFLFDLNLAQNYLTGPLSASIGNLTSMQYLTLGINALSGELPKELGNLTDLRTFAFGANNFSGPLPSELGSLTKLKEIYFDSSGVSGEIPSTFANLQNLEIVWASDTELTGRIPDFIGNWSKLSVLRFQGNSFEGPIPVTFSKLTSLTELRISDLSNVNGSSSLGFIKDMKSLSILVLRNNNISDSIPSNIGEYQSLSQLDLSFNNLTGQIPDSLFNLSSLSILFLGNNKLNGTLPESKSSSLLNIDLSYNNLLGSFPSWVNEQKLQLNLVANNFSIESSNSSALPSGLNCLQQNFPCNRGTGLYYNLGIKCGGPQITSSNGIVYENENQTLGPATYFVTGTNKWGVSNVGYFTSTNNPQYTSFSLSQFKNTLDSEIFQTARLSASSLRYYGLGLENGNYTVTLQFAETAILDSTTWKSLGKRVFDIYIQGNLFLKDFDIRKEAGASFQAVQKEYAAQVSENYLEIHLFWAGKGTCCIPGQGTYGPVISAISATPDFIPTVSNNPTTSKKNRTGLIVGIIVGGGVLILMVAIFYIFQRRKRTNTMDDEELLGIDIGPLTFSFSELKSATNDFNPDNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYGFCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSRVVGMLSGDIEVATVTSKPGYLTDWKFDDISGINSMTIDMSTKGTDSSVYNSSASTTVVGDTSQLPAKATQPIIYNTVRNGR*

Domains

Domain Start-End Description Sequence

Seg: seg
2-17 seg

SGTGTSASSSSSSSAS

Seg: seg
23-39 seg

AAAAFCCIFGFGGIGIA

HMMPanther: PTHR24420
49-1047 FAMILY NOT NAMED,FAMILY NOT NAMED

QATTDPSEVRALNSIFAQWKISANQRQWNTTGDPCSGAAIDSTAFGDEDYNPFIKCDCSFDSNSTCHITQLKVYSLDVVGVIPVELWTLTFLFDLNLAQNYLTGPLSASIGNLTSMQYLTLGINALSGELPKELGNLTDLRTFAFGANNFSGPLPSELGSLTKLKEIYFDSSGVSGEIPSTFANLQNLEIVWASDTELTGRIPDFIGNWSKLSVLRFQGNSFEGPIPVTFSKLTSLTELRISDLSNVNGSSSLGFIKDMKSLSILVLRNNNISDSIPSNIGEYQSLSQLDLSFNNLTGQIPDSLFNLSSLSILFLGNNKLNGTLPESKSSSLLNIDLSYNNLLGSFPSWVNEQKLQLNLVANNFSIESSNSSALPSGLNCLQQNFPCNRGTGLYYNLGIKCGGPQITSSNGIVYENENQTLGPATYFVTGTNKWGVSNVGYFTSTNNPQYTSFSLSQFKNTLDSEIFQTARLSASSLRYYGLGLENGNYTVTLQFAETAILDSTTWKSLGKRVFDIYIQGNLFLKDFDIRKEAGASFQAVQKEYAAQVSENYLEIHLFWAGKGTCCIPGQGTYGPVISAISATPDFIPTVSNNPTTSKKNRTGLIVGIIVGGGVLILMVAIFYIFQRRKRTNTMDDEELLGIDIGPLTFSFSELKSATNDFNPDNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYGFCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSRVVGMLSGDIEVATVTSKPGYLTDWKFDDISGINSMTIDMSTKGTDSSVYNSSASTTVVGDTSQLPAKATQPIIYN

HMMPanther: PTHR24420:SF469
49-1047 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QATTDPSEVRALNSIFAQWKISANQRQWNTTGDPCSGAAIDSTAFGDEDYNPFIKCDCSFDSNSTCHITQLKVYSLDVVGVIPVELWTLTFLFDLNLAQNYLTGPLSASIGNLTSMQYLTLGINALSGELPKELGNLTDLRTFAFGANNFSGPLPSELGSLTKLKEIYFDSSGVSGEIPSTFANLQNLEIVWASDTELTGRIPDFIGNWSKLSVLRFQGNSFEGPIPVTFSKLTSLTELRISDLSNVNGSSSLGFIKDMKSLSILVLRNNNISDSIPSNIGEYQSLSQLDLSFNNLTGQIPDSLFNLSSLSILFLGNNKLNGTLPESKSSSLLNIDLSYNNLLGSFPSWVNEQKLQLNLVANNFSIESSNSSALPSGLNCLQQNFPCNRGTGLYYNLGIKCGGPQITSSNGIVYENENQTLGPATYFVTGTNKWGVSNVGYFTSTNNPQYTSFSLSQFKNTLDSEIFQTARLSASSLRYYGLGLENGNYTVTLQFAETAILDSTTWKSLGKRVFDIYIQGNLFLKDFDIRKEAGASFQAVQKEYAAQVSENYLEIHLFWAGKGTCCIPGQGTYGPVISAISATPDFIPTVSNNPTTSKKNRTGLIVGIIVGGGVLILMVAIFYIFQRRKRTNTMDDEELLGIDIGPLTFSFSELKSATNDFNPDNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYGFCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSRVVGMLSGDIEVATVTSKPGYLTDWKFDDISGINSMTIDMSTKGTDSSVYNSSASTTVVGDTSQLPAKATQPIIYN

Gene3D: G3DSA:3.80.10.10
95-292 no description

DEDYNPFIKCDCSFDSNSTCHITQLKVYSLDVVGVIPVELWTLTFLFDLNLAQNYLTGPLSASIGNLTSMQYLTLGINALSGELPKELGNLTDLRTFAFGANNFSGPLPSELGSLTKLKEIYFDSSGVSGEIPSTFANLQNLEIVWASDTELTGRIPDFIGNWSKLSVLRFQGNSFEGPIPVTFSKLTSLTELRISDL

superfamily: SSF52058
103-393 L domain-like,LRR

KCDCSFDSNSTCHITQLKVYSLDVVGVIPVELWTLTFLFDLNLAQNYLTGPLSASIGNLTSMQYLTLGINALSGELPKELGNLTDLRTFAFGANNFSGPLPSELGSLTKLKEIYFDSSGVSGEIPSTFANLQNLEIVWASDTELTGRIPDFIGNWSKLSVLRFQGNSFEGPIPVTFSKLTSLTELRISDLSNVNGSSSLGFIKDMKSLSILVLRNNNISDSIPSNIGEYQSLSQLDLSFNNLTGQIPDSLFNLSSLSILFLGNNKLNGTLPESKSSSLLNIDLSYNNLLGS

Gene3D: G3DSA:3.80.10.10
298-413 no description

SSSLGFIKDMKSLSILVLRNNNISDSIPSNIGEYQSLSQLDLSFNNLTGQIPDSLFNLSSLSILFLGNNKLNGTLPESKSSSLLNIDLSYNNLLGSFPSWVNEQKLQLNLVANNFS

HMMPfam: PF00560
IPR001611
309-328 LRR_1
Leucine-rich repeat

SLSILVLRNNNISDSIPSNI

Seg: seg
317-328 seg

NNNISDSIPSNI

HMMPfam: PF00560
IPR001611
333-354 LRR_1
Leucine-rich repeat

SLSQLDLSFNNLTGQIPDSLFN

Seg: seg
351-363 seg

SLFNLSSLSILFL

HMMPfam: PF11721
IPR021720
444-628 Malectin
Malectin

NLGIKCGGPQITSSNGIVYENENQTLGPATYFVTGTNKWGVSNVGYFTSTNNPQYTSFSLSQFKNTLDSEIFQTARLSASSLRYYGLGLENGNYTVTLQFAETAILDSTTWKSLGKRVFDIYIQGNLFLKDFDIRKEAGASFQAVQKEYAAQVSENYLEIHLFWAGKGTCCIPGQGTYGPVISAI

Seg: seg
651-665 seg

GLIVGIIVGGGVLIL

superfamily: SSF56112
IPR011009
679-977 Protein kinase-like (PK-like)
Protein kinase-like domain

TNTMDDEELLGIDIGPLTFSFSELKSATNDFNPDNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYGFCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSRVVGML

Gene3D: G3DSA:3.30.200.20
696-770 no description

TFSFSELKSATNDFNPDNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYG

HMMSmart: SM00220
IPR002290
709-977 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNPDNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYGFCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSRVVGML

ProfileScan: PS50011
IPR000719
709-983 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNPDNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYGFCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSRVVGMLSGDIEV

HMMSmart: SM00219
IPR020635
709-977 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNPDNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYGFCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSRVVGML

HMMPfam: PF07714
IPR001245
712-976 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

DNKLGEGGFGPVYKGTLNDGRVIAVKQLSAASHQGKSQFVTEIATISAVQHNNLVDLYGFCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSRVVGM

Gene3D: G3DSA:1.10.510.10
771-972 no description

FCVEGDKRLLVYEYLENNSLDQALFGKRSLNLDWSTRFDICLGVARGLTYLHEESRLRIVHRDVKASNILLDSNLIPKISDFGLAKLYDDKKTHISTGVAGTIGYLAPEYAMRGHLTEKSDVFSFGVVALETVSGRPNSDPSLDEEKIYLLEWAWYLHETKREVELVDSRLSEFNEEEVKRVIAIAFLCTQASPLLRPSMSR

PatternScan: PS00108
IPR008271
829-841 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKASNILL

Coil: coil
927-948 coiled-coil

LHETKREVELVDSRLSEFNEEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox