PRGDB00172551 (ppb019715m)

From PRG Wiki
Jump to: navigation, search
ppb019715m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGCCAAATGTTGACACATTTGATGAACTGGTAGATCTTTTTGCAGTACAAAGACGTCGTTTTGTATTTTTTGATGACGTTGTATTGTTTAACAACGACGGTTATTTAGCGTCGTGGTTTATGAGGGAAAAGATGACGCTTCCTGAATTTCTTGGCAAATTTCGAGTTCGTAAGCTTCTCAATCTTTCTCGTAATGATTTCGAGGGTGAAATGCCTAGAGAAGGGATTTTTACAAATGCAAGCGGTGTCTCCATTTTCGGAAATGTAAAGCCCCATTCATCTCAAAGACCATTTTCCCAAAGAGTAGTCATCGTTATAGCTTGTGCATTTGCATTCATAATTGCTATGTCATGTTCCATTGCTATATATTCAAAGGTGAAAATGTCACGAGGAAGTTTTGGTTCTCTTTACAAAGGAGTAATCCCTAGAGATGGAACAATAGTTTCTGTTAAGGTATTGAACCTTCAACAACAAGGATCTTTCAAGAGTTTCATTGATGAACGCAAAGCTTTAAGAAGTATAAGGCATCGTAATCTTCTAAAGATCCTAACTGCCTGCTCAGGCATCGATAATCTGGGTAATGAGTTCAGAAGTCTAGTCTTCAAGTACATGGAAAATGGAAGTCTAGACTCATGGTTGTATCCAAGAGATGAGGAGCAATGGAAAATTAAGACCTTGGGTGTTGTCCAAAGAATGAACATTGCTATTGATGTTGCTTCTGCTTTAGATTATCTCCATCACCATTGTGAAGGGGCCATTGTTCATTGTGATCTAAAGCCAAGCAATGTTCTTCTTGATGAGGATATGGTAGCCCATGTTGGTGACTTTGGTGTAGCAAGGTTCCTTTTGGAAACATCAAATGATCCCTCCCAGAGTCAAACAATATGTCAACTGGGTTAA


Protein sequences

Name Description Sequence
ppb019715m Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

MPNVDTFDELVDLFAVQRRRFVFFDDVVLFNNDGYLASWFMREKMTLPEFLGKFRVRKLLNLSRNDFEGEMPREGIFTNASGVSIFGNVKPHSSQRPFSQRVVIVIACAFAFIIAMSCSIAIYSKVKMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIRHRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLETSNDPSQSQTICQLG*

Domains

Domain Start-End Description Sequence

Seg: seg
18-28 seg

RRRFVFFDDVV

HMMPanther: PTHR24420:SF474
46-292 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TLPEFLGKFRVRKLLNLSRNDFEGEMPREGIFTNASGVSIFGNVKPHSSQRPFSQRVVIVIACAFAFIIAMSCSIAIYSKVKMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIRHRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLETSNDPSQS

HMMPanther: PTHR24420
46-292 FAMILY NOT NAMED,FAMILY NOT NAMED

TLPEFLGKFRVRKLLNLSRNDFEGEMPREGIFTNASGVSIFGNVKPHSSQRPFSQRVVIVIACAFAFIIAMSCSIAIYSKVKMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIRHRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLETSNDPSQS

superfamily: SSF56112
IPR011009
92-285 Protein kinase-like (PK-like)
Protein kinase-like domain

HSSQRPFSQRVVIVIACAFAFIIAMSCSIAIYSKVKMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIRHRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLET

Seg: seg
102-115 seg

VVIVIACAFAFIIA

ProfileScan: PS50011
IPR000719
122-299 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IYSKVKMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIRHRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLETSNDPSQSQTICQLG

HMMSmart: SM00220
IPR002290
122-295 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

IYSKVKMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIRHRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLETSNDPSQSQTI

HMMSmart: SM00219
IPR020635
122-298 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IYSKVKMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIRHRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLETSNDPSQSQTICQL

HMMPfam: PF00069
IPR000719
127-289 Pkinase,Ser-thr
Protein kinase, catalytic domain

KMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIRHRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLETSNDP

Gene3D: G3DSA:3.30.200.20
127-175 no description

KMSRGSFGSLYKGVIPRDGTIVSVKVLNLQQQGSFKSFIDERKALRSIR

Gene3D: G3DSA:1.10.510.10
176-287 no description

HRNLLKILTACSGIDNLGNEFRSLVFKYMENGSLDSWLYPRDEEQWKIKTLGVVQRMNIAIDVASALDYLHHHCEGAIVHCDLKPSNVLLDEDMVAHVGDFGVARFLLETSN

PatternScan: PS00108
IPR008271
253-265 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDLKPSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox