PRGDB00172556 (ppa017069m)

From PRG Wiki
Jump to: navigation, search
ppa017069m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Leucine-rich receptor-like protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGCTCATGGCTTCCTTCTCTTCCTCTTATTCTCTTGCATTATTTCAACAAATATTCATGCCTGCAAACCAACTGAACGCAGCTCCCTCCTGTCCTTTGCCTCAACTCTATCTTCTCTTCATTTAAATTGGACATCTATTGATTGCTGTCGTTGGAAGGGCATCACTTGTGATCAAGATGGTTGGGTCACCCATTTGCTCTTGCCTTCCAAAGGGCTCAAAGGAGGTATCCCTTCTTCTTCACTTGGAAATCTCACACATCTCACCCACGTGAACTTTTCCCATAATTCACTATATGGTTCACTTGATACTCAGTTCTTCATGTCTTTGAATCGACTCGAGTTCCTTGATTTGAGCTATAACCTTCTTTCTGAAGAGCTACCACTTTCTCTACCATCTAGCAATATCCGGACAGTGGATTTGTCCAGCAATCACTTTCATGGTGCAATTCCACCTTCATTCTTCCAACAAGCAAGCAACTTGACTAGTTTCAATGTCAGCAACAACACCTTGACAGGGTATGTTCCATCCTCTATTTGTCTCAGACATTCTTCTCCCTTCCTTAGGCTGTTGGATTTTTCTTCCAATGCATTCAGTGGCAACCTTGCTCCCGGGCTAGGGAAGTGTTCTGAACTGCAAGTTTTTCGTGTCGGTCACAATAACCTCTCAGGATTACTTCCAGAAGATATCTATAATTGTACCAAACTTGAAGAAATTGCATTACCTCTCAATTTTCTACATGGCACCATTAGTGATAAAATTGTCAACCTGACTAACCTCGCAAGCCTTGATCTCTACTATAATCATTTTGATGGTGAGCTTCCTCTCAATTTGGGGAAGCTATCTATGTTGAAGTTTTTGACCTTTGATTTCAACAATTTAGAAGGTGCTTTGCCCCCATCTTTGATGAATTGCACAAACCTTGTAGAATTGCGTTTGGGATCCAACAATTTGGAAGGAGATATATCCATGCTTGATTTTTCCAGACTTAGTCAACTTACTAAGCTTGACCTAAGGAGGAATAACTTCACTGGTACAATTCCAAGAAGTCTTTACTCGTGTAGGTCCGTAAAAGCCATTGGATTGTCTGGAAATCTTCTAGAGGGACAAATAGAAGATGATATTCTTTCATTGAAATCCTTGTCCTTCCTCTCTCTTGGTTACAACCGATTCACCAACCTCACAGGGGCAATGAAGATGTTGATGAGTTGCAGAAGTCTTCACGCACTCATGCTTGGTGGTTCCTTTGTGGGTGAGGGAATGCCAAGTGATGATGACATGGTTGATTTTCATGGATTCAAAAATCTTCGGTTATTGAATTTGGATGATTGTCAACTCACTGGTCAAATACCTCTATGGCTGTCAAAGCTTAGGAATCTAGAGGTCTTGTTTCTGGCTTATAATCAAATCACAGGGCCAATTCCAAGTTGGTTGGGAACTCTTCCTAGACTTTTTTATATAAACTTGAAAGACAACCGAATTTCAGGTGAATTTCCGAAGCAACTTTGTAGACTACCAAGGTTGGTTTATGAACCTAACATTGCATCTCAAGTAGAAGCTTTTGAAATTGAATTACCTCTCACCATCGGCCAAAACTCAAATCCAACTTTTCTACCCCACAGATTGGCTTACTTTGCAGCATCGTTAGACCTATCTAACAATAACATCAATGGTCATATACCTGCTGAGATCGGCCAATTGCAGTTTCTCCACAAGTTGGCTCTTAACTCCAACAACTTCTCCGGTATCATTCCAGACCAAATATCTAACCTGAAAAATTTAGAGGTTTTTAACCTCTCCATGAATCACTTGTCTGGAATAATCCCATTATCATTGGCGAGCCTTAATTTCTTAAAAGAATTTGATGTCTCATACAATAGCCTTGAAGGACCAATACCAACAAGCACCCAGCTCCAAAGCTTCGAAGCTTCTGCGTTTGAGGGGAACCTAAAACTTTGTGGTGCGCCACTTCCAAATAAGTGTAGCCCAAATAAGGGCATTGATGCAGATAACAAGAACAACAAAGACATGCACAATGGGCTTCATCAACTTCCA


Protein sequences

Name Description Sequence
ppa017069m Leucine-rich receptor-like protein kinase family protein (best arabidopsis hit)

MAHGFLLFLLFSCIISTNIHACKPTERSSLLSFASTLSSLHLNWTSIDCCRWKGITCDQDGWVTHLLLPSKGLKGGIPSSSLGNLTHLTHVNFSHNSLYGSLDTQFFMSLNRLEFLDLSYNLLSEELPLSLPSSNIRTVDLSSNHFHGAIPPSFFQQASNLTSFNVSNNTLTGYVPSSICLRHSSPFLRLLDFSSNAFSGNLAPGLGKCSELQVFRVGHNNLSGLLPEDIYNCTKLEEIALPLNFLHGTISDKIVNLTNLASLDLYYNHFDGELPLNLGKLSMLKFLTFDFNNLEGALPPSLMNCTNLVELRLGSNNLEGDISMLDFSRLSQLTKLDLRRNNFTGTIPRSLYSCRSVKAIGLSGNLLEGQIEDDILSLKSLSFLSLGYNRFTNLTGAMKMLMSCRSLHALMLGGSFVGEGMPSDDDMVDFHGFKNLRLLNLDDCQLTGQIPLWLSKLRNLEVLFLAYNQITGPIPSWLGTLPRLFYINLKDNRISGEFPKQLCRLPRLVYEPNIASQVEAFEIELPLTIGQNSNPTFLPHRLAYFAASLDLSNNNINGHIPAEIGQLQFLHKLALNSNNFSGIIPDQISNLKNLEVFNLSMNHLSGIIPLSLASLNFLKEFDVSYNSLEGPIPTSTQLQSFEASAFEGNLKLCGAPLPNKCSPNKGIDADNKNNKDMHNGLHQLP


Domains

Domain Start-End Description Sequence

Seg: seg
5-11 seg

FLLFLLF

HMMPanther: PTHR24420
6-654 FAMILY NOT NAMED,FAMILY NOT NAMED

LLFLLFSCIISTNIHACKPTERSSLLSFASTLSSLHLNWTSIDCCRWKGITCDQDGWVTHLLLPSKGLKGGIPSSSLGNLTHLTHVNFSHNSLYGSLDTQFFMSLNRLEFLDLSYNLLSEELPLSLPSSNIRTVDLSSNHFHGAIPPSFFQQASNLTSFNVSNNTLTGYVPSSICLRHSSPFLRLLDFSSNAFSGNLAPGLGKCSELQVFRVGHNNLSGLLPEDIYNCTKLEEIALPLNFLHGTISDKIVNLTNLASLDLYYNHFDGELPLNLGKLSMLKFLTFDFNNLEGALPPSLMNCTNLVELRLGSNNLEGDISMLDFSRLSQLTKLDLRRNNFTGTIPRSLYSCRSVKAIGLSGNLLEGQIEDDILSLKSLSFLSLGYNRFTNLTGAMKMLMSCRSLHALMLGGSFVGEGMPSDDDMVDFHGFKNLRLLNLDDCQLTGQIPLWLSKLRNLEVLFLAYNQITGPIPSWLGTLPRLFYINLKDNRISGEFPKQLCRLPRLVYEPNIASQVEAFEIELPLTIGQNSNPTFLPHRLAYFAASLDLSNNNINGHIPAEIGQLQFLHKLALNSNNFSGIIPDQISNLKNLEVFNLSMNHLSGIIPLSLASLNFLKEFDVSYNSLEGPIPTSTQLQSFEASAFEGNLKLCG

HMMPanther: PTHR24420:SF515
6-654 SUBFAMILY NOT NAMED

LLFLLFSCIISTNIHACKPTERSSLLSFASTLSSLHLNWTSIDCCRWKGITCDQDGWVTHLLLPSKGLKGGIPSSSLGNLTHLTHVNFSHNSLYGSLDTQFFMSLNRLEFLDLSYNLLSEELPLSLPSSNIRTVDLSSNHFHGAIPPSFFQQASNLTSFNVSNNTLTGYVPSSICLRHSSPFLRLLDFSSNAFSGNLAPGLGKCSELQVFRVGHNNLSGLLPEDIYNCTKLEEIALPLNFLHGTISDKIVNLTNLASLDLYYNHFDGELPLNLGKLSMLKFLTFDFNNLEGALPPSLMNCTNLVELRLGSNNLEGDISMLDFSRLSQLTKLDLRRNNFTGTIPRSLYSCRSVKAIGLSGNLLEGQIEDDILSLKSLSFLSLGYNRFTNLTGAMKMLMSCRSLHALMLGGSFVGEGMPSDDDMVDFHGFKNLRLLNLDDCQLTGQIPLWLSKLRNLEVLFLAYNQITGPIPSWLGTLPRLFYINLKDNRISGEFPKQLCRLPRLVYEPNIASQVEAFEIELPLTIGQNSNPTFLPHRLAYFAASLDLSNNNINGHIPAEIGQLQFLHKLALNSNNFSGIIPDQISNLKNLEVFNLSMNHLSGIIPLSLASLNFLKEFDVSYNSLEGPIPTSTQLQSFEASAFEGNLKLCG

superfamily: SSF52058
20-225 L domain-like,LRR

HACKPTERSSLLSFASTLSSLHLNWTSIDCCRWKGITCDQDGWVTHLLLPSKGLKGGIPSSSLGNLTHLTHVNFSHNSLYGSLDTQFFMSLNRLEFLDLSYNLLSEELPLSLPSSNIRTVDLSSNHFHGAIPPSFFQQASNLTSFNVSNNTLTGYVPSSICLRHSSPFLRLLDFSSNAFSGNLAPGLGKCSELQVFRVGHNNLSGL

Gene3D: G3DSA:3.80.10.10
22-236 no description

CKPTERSSLLSFASTLSSLHLNWTSIDCCRWKGITCDQDGWVTHLLLPSKGLKGGIPSSSLGNLTHLTHVNFSHNSLYGSLDTQFFMSLNRLEFLDLSYNLLSEELPLSLPSSNIRTVDLSSNHFHGAIPPSFFQQASNLTSFNVSNNTLTGYVPSSICLRHSSPFLRLLDFSSNAFSGNLAPGLGKCSELQVFRVGHNNLSGLLPEDIYNCTKL

HMMPfam: PF08263
IPR013210
25-58 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TERSSLLSFASTLSSLHLNWTSIDCCRWKGITCD

Seg: seg
28-42 seg

SSLLSFASTLSSLHL

HMMPfam: PF13855
73-123 LRR_8,Leucine rich repeat

LKGGIPSSSLGNLTHLTHVNFSHNSLYGSLDTQFFMSLNRLEFLDLSYNLL

HMMSmart: SM00369
IPR003591
85-109 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTHLTHVNFSHNSLYGSLDTQFFMS

HMMSmart: SM00369
IPR003591
110-134 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LNRLEFLDLSYNLLSEELPLSLPSS

Seg: seg
118-135 seg

LSYNLLSEELPLSLPSSN

HMMPfam: PF00560
IPR001611
135-156 LRR_1
Leucine-rich repeat

NIRTVDLSSNHFHGAIPPSFFQ

HMMPfam: PF13516
159-180 LRR_6,Leucine Rich repeat

SNLTSFNVSNNTLTGYVPSSIC

superfamily: SSF52058
183-510 L domain-like,LRR

HSSPFLRLLDFSSNAFSGNLAPGLGKCSELQVFRVGHNNLSGLLPEDIYNCTKLEEIALPLNFLHGTISDKIVNLTNLASLDLYYNHFDGELPLNLGKLSMLKFLTFDFNNLEGALPPSLMNCTNLVELRLGSNNLEGDISMLDFSRLSQLTKLDLRRNNFTGTIPRSLYSCRSVKAIGLSGNLLEGQIEDDILSLKSLSFLSLGYNRFTNLTGAMKMLMSCRSLHALMLGGSFVGEGMPSDDDMVDFHGFKNLRLLNLDDCQLTGQIPLWLSKLRNLEVLFLAYNQITGPIPSWLGTLPRLFYINLKDNRISGEFPKQLCRLPRLVY

Gene3D: G3DSA:3.80.10.10
237-405 no description

EEIALPLNFLHGTISDKIVNLTNLASLDLYYNHFDGELPLNLGKLSMLKFLTFDFNNLEGALPPSLMNCTNLVELRLGSNNLEGDISMLDFSRLSQLTKLDLRRNNFTGTIPRSLYSCRSVKAIGLSGNLLEGQIEDDILSLKSLSFLSLGYNRFTNLTGAMKMLMSCR

HMMSmart: SM00369
IPR003591
257-281 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLASLDLYYNHFDGELPLNLGKL

HMMPfam: PF13855
284-343 LRR_8,Leucine rich repeat

LKFLTFDFNNLEGALPPSLMNCTNLVELRLGSNNLEGDISMLDFSRLSQLTKLDLRRNNF

HMMSmart: SM00369
IPR003591
330-354 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSQLTKLDLRRNNFTGTIPRSLYSC

Seg: seg
376-386 seg

LSLKSLSFLSL

HMMSmart: SM00369
IPR003591
378-400 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLSFLSLGYNRFTNLTGAMKM

superfamily: SSF52058
429-661 L domain-like,LRR

DFHGFKNLRLLNLDDCQLTGQIPLWLSKLRNLEVLFLAYNQITGPIPSWLGTLPRLFYINLKDNRISGEFPKQLCRLPRLVYEPNIASQVEAFEIELPLTIGQNSNPTFLPHRLAYFAASLDLSNNNINGHIPAEIGQLQFLHKLALNSNNFSGIIPDQISNLKNLEVFNLSMNHLSGIIPLSLASLNFLKEFDVSYNSLEGPIPTSTQLQSFEASAFEGNLKLCGAPLPNKC

HMMPfam: PF13855
435-494 LRR_8,Leucine rich repeat

NLRLLNLDDCQLTGQIPLWLSKLRNLEVLFLAYNQITGPIPSWLGTLPRLFYINLKDNRI

HMMSmart: SM00369
IPR003591
457-481 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLEVLFLAYNQITGPIPSWLGTL

Gene3D: G3DSA:3.80.10.10
548-657 no description

SLDLSNNNINGHIPAEIGQLQFLHKLALNSNNFSGIIPDQISNLKNLEVFNLSMNHLSGIIPLSLASLNFLKEFDVSYNSLEGPIPTSTQLQSFEASAFEGNLKLCGAPL

HMMPfam: PF00560
IPR001611
548-567 LRR_1
Leucine-rich repeat

SLDLSNNNINGHIPAEIGQL

HMMSmart: SM00369
IPR003591
567-590 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQFLHKLALNSNNFSGIIPDQISN

HMMPfam: PF13855
570-628 LRR_8,Leucine rich repeat

LHKLALNSNNFSGIIPDQISNLKNLEVFNLSMNHLSGIIPLSLASLNFLKEFDVSYNSL

HMMSmart: SM00369
IPR003591
591-614 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLEVFNLSMNHLSGIIPLSLAS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox