PRGDB00172557 (ppa003394m)

From PRG Wiki
Jump to: navigation, search
ppa003394m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

receptor-like kinase in in flowers 3 (best arabidopsis hit)

DNA Sequence

ATGCTTGAAGGAATCCGGTTGCTTCGATCAGAATATCTCAGAACCACCGGCTACTTTTCCCCGCCTTCCAATGCCGCCGAGGCATGTTGGCATGCCTATGAAAGTTTGAGCAATGAGTCGTTACCCGGGTTCGGGGTTCAATCCACTTGTGGATTTAAGGCCAGTTTGATGACAGGGGGTTGCATGAATATCACAACCCGGTCACAGTTTGAAAGCCTGATTTCTCAATCTGAGCTGCAGGGAATTCAGGACTCTTGCAATCAGTCTTTGGAGAATAATTCAACTTGTGATTCATGTAAGCAGAGGTTGTGGCGTGTGAGTGCTGCTAACTTTGGTAGGCCTGTGGATGGGAATGAATCAGATTGCAATAGCTATCCATTTATGTATGCTGCAGCTTTTGCTAGCAGGTATGGGCCTACAAACTTGGGCACAGTCAAGTGTTTGTTTTCACTAGATTTCAATGCCTTTAATGTAAATACTAAAAGGATCAAGCATACCAAGGTAATGCATAGGGCAGTGTTGGTAGGATGTGTTAGTGGGTTCTTTGTGGCAGTTTTGGTGGTTTGGGTTCTTTGGAGAAGGCACAAGAAGTACAGGGGAAGGAAGAGAAACATGGAGTCAACCGAGATGGGTTTTGCTTCAGCCATGGAGATTATTGGTGAAAATACCAGTTTGGTTAAGTTCCCATTAGAGGAAATCAAAAAGGCTACCAAGAATTTCTCAAGGGAGAACATAATTGGGATGGGAGGCTATGGGAATGTCTATAAGGGAATATTAGCTGATGGGTCTGAAGTAGCTTTGAAAAGGTTCAAGAACTTCTCTGCTGGTGGGGATGAAGCTTTTGCACATGAGGTGGAGGTTATTGCAAGCATTAGGCATGTGAATCTTGTTACTGTGAGAGGCTATTGTACTGTGGCTGTGCCTTTGCAAGGCCACCAGAGGATAATTGTGTGTGAATTGGTGCACAATGGAAGCCTCTATGATCATCTTTTTGATTCAAGGATGAAGAAACTCAGTTGGCCAATTCGACAAAAGATTGCTAGTGGAATTGCCCGCGGATTGGCTTATTTGCATTACGGTGTAGAGCCTGCCATCATCCACAGAGATGTTAAAGCTAGTAACATACTTCTAGATCAAACATTTGAGCCAAAACTGGCTGATTTTGGCTTTGCAAAGTTCACACCAGAAGGATTTACACATTTGAGCACAAGGGTAGCTGGGACACTAGGATATGTTGCACCTGAATATGCCATGTATGGACAATTATCAGAAAGAAGTGATGTCTACAGTTATGGGGTAGTGCTTCTTGAGCTTCTGAGTGGGAAAAAAGCAGTTGCAGAAGCTGATGGCACCGGAATTTTGCTGTTGGCAGATTGGGCTTGGTCCCAAGTGAGGGAAGGCAACCCATTAGATGTTGTAGATGAAAGCATGCCTGAGTTGGGCTTTGCAGAAGTTATGGAAAGGCATGTTTTAGTTGCAGCTCTTTGCTCTCATCCAGTAGCATATGCAAGGCCAACAATGGACCAAGTTGTGAAGATGTTGGAATCAGATTTTCCACTTCCCTCAATCCCAGATTGCCCTCTTGTTGATGAAATGGTTAAAATAGATCAGCCAGCTAGCTTTAGTGGCTCAAGATACATTTCAAGCCCTGAGGGCCAGCAACCATGTAGCTATGAGAGTGACCATCCCATTCCAAGTGATTTGGAGAAAGTGGGAAGTTCACAAAAACACATGTAA


Protein sequences

Name Description Sequence
ppa003394m receptor-like kinase in in flowers 3 (best arabidopsis hit)

MLEGIRLLRSEYLRTTGYFSPPSNAAEACWHAYESLSNESLPGFGVQSTCGFKASLMTGGCMNITTRSQFESLISQSELQGIQDSCNQSLENNSTCDSCKQRLWRVSAANFGRPVDGNESDCNSYPFMYAAAFASRYGPTNLGTVKCLFSLDFNAFNVNTKRIKHTKVMHRAVLVGCVSGFFVAVLVVWVLWRRHKKYRGRKRNMESTEMGFASAMEIIGENTSLVKFPLEEIKKATKNFSRENIIGMGGYGNVYKGILADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELVHNGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEADGTGILLLADWAWSQVREGNPLDVVDESMPELGFAEVMERHVLVAALCSHPVAYARPTMDQVVKMLESDFPLPSIPDCPLVDEMVKIDQPASFSGSRYISSPEGQQPCSYESDHPIPSDLEKVGSSQKHM*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:2.60.120.200
IPR013320
154-259 no description
Concanavalin A-like lectin/glucanase, subgroup

NAFNVNTKRIKHTKVMHRAVLVGCVSGFFVAVLVVWVLWRRHKKYRGRKRNMESTEMGFASAMEIIGENTSLVKFPLEEIKKATKNFSRENIIGMGGYGNVYKGIL

HMMPanther: PTHR24420:SF895
173-533 SUBFAMILY NOT NAMED

VLVGCVSGFFVAVLVVWVLWRRHKKYRGRKRNMESTEMGFASAMEIIGENTSLVKFPLEEIKKATKNFSRENIIGMGGYGNVYKGILADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELVHNGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEADGTGILLLADWAWSQVREGNPLDVVDESMPELGFAEVMERHVLVAALCSHPVAYARPTMDQVVKMLESDFPLPSIPDCPLVDEMV

HMMPanther: PTHR24420
173-533 FAMILY NOT NAMED,FAMILY NOT NAMED

VLVGCVSGFFVAVLVVWVLWRRHKKYRGRKRNMESTEMGFASAMEIIGENTSLVKFPLEEIKKATKNFSRENIIGMGGYGNVYKGILADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELVHNGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEADGTGILLLADWAWSQVREGNPLDVVDESMPELGFAEVMERHVLVAALCSHPVAYARPTMDQVVKMLESDFPLPSIPDCPLVDEMV

Seg: seg
181-194 seg

FFVAVLVVWVLWRR

superfamily: SSF56112
IPR011009
210-514 Protein kinase-like (PK-like)
Protein kinase-like domain

MGFASAMEIIGENTSLVKFPLEEIKKATKNFSRENIIGMGGYGNVYKGILADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELVHNGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEADGTGILLLADWAWSQVREGNPLDVVDESMPELGFAEVMERHVLVAALCSHPVAYARPTMDQVVKML

HMMSmart: SM00219
IPR020635
240-514 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSRENIIGMGGYGNVYKGILADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELVHNGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEADGTGILLLADWAWSQVREGNPLDVVDESMPELGFAEVMERHVLVAALCSHPVAYARPTMDQVVKML

HMMSmart: SM00220
IPR002290
240-514 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSRENIIGMGGYGNVYKGILADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELVHNGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEADGTGILLLADWAWSQVREGNPLDVVDESMPELGFAEVMERHVLVAALCSHPVAYARPTMDQVVKML

ProfileScan: PS50011
IPR000719
240-518 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSRENIIGMGGYGNVYKGILADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELVHNGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEADGTGILLLADWAWSQVREGNPLDVVDESMPELGFAEVMERHVLVAALCSHPVAYARPTMDQVVKMLESDF

HMMPfam: PF00069
IPR000719
242-448 Pkinase,Ser-thr
Protein kinase, catalytic domain

RENIIGMGGYGNVYKGILADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELVHNGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEA

PatternScan: PS00107
IPR017441
246-268 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGMGGYGNVYKGILADGSEVALK

Gene3D: G3DSA:3.30.200.20
260-321 no description

ADGSEVALKRFKNFSAGGDEAFAHEVEVIASIRHVNLVTVRGYCTVAVPLQGHQRIIVCELV

Gene3D: G3DSA:1.10.510.10
323-514 no description

NGSLYDHLFDSRMKKLSWPIRQKIASGIARGLAYLHYGVEPAIIHRDVKASNILLDQTFEPKLADFGFAKFTPEGFTHLSTRVAGTLGYVAPEYAMYGQLSERSDVYSYGVVLLELLSGKKAVAEADGTGILLLADWAWSQVREGNPLDVVDESMPELGFAEVMERHVLVAALCSHPVAYARPTMDQVVKML

PatternScan: PS00108
IPR008271
365-377 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox