PRGDB00172561 (ppa010140m)

From PRG Wiki
Jump to: navigation, search
ppa010140m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

receptor like protein 1 (best arabidopsis hit)

DNA Sequence

ATGAACATCATCTCTGGAAGCATACCCAAATGCCTCACCAATTTAACTACTCTGGCTCAGAAAGGAAATTCAAGTCTGAACATCTCACATTCTTATGAAATTTCTACCATCAATTTGGTAGATTTTTATGACGATGATGCAACCTTTATGTGGAAAGGAGGAATGCAGACATACAAAAGTACTTTGGGGCTCGTGAAGAGAATTGATCTGTCAAGCAATAAATTAACAGGGGAGATTCCGAGTGAAATCACTCATCTTGTTGGGTTAGTTTCTTTAAACCTATCGAGAAACCAATTAACAGGTCAAATAACTCCAAAGATCGGAAACTTGCAGTCATTGGATTCTCTTGATTTGTCACGAAACCATATAGACGGAAGAATTCCAACAAGCCTTGCTCGGATAGATCGTCTTGGTTTCTTGGACTTGTCATATAACAACTTGTCTGGCAAAATTCCAGTCGGAACTCAACTCCAAGGCTTTGATCCCTCTTTTTATGCTGGGAATCTTCAACTCTGTGGACCTCCACTTAAAAAGATGTGTGCTGATGAAGTGGAAAAAGGTCAAAGTGAGCAAACTGACTTCATCAACCAAGAGGACAAGGATGAGCTAATAACACCGGGATTCTACATTAGTATGGGGCTTGGATTTGCTGCTGGATTTTGGGGAGTTTGCGGCACCTTGATATTTTCAAGGTCATGGAGATACACATACTTGAAGTTCTTGAATGATTTAAATGATTGGCTTTTTGTGAGGATAGCTTTGTTGAAGCGGCAATTGAGGGATGCTTAA


Protein sequences

Name Description Sequence
ppa010140m receptor like protein 1 (best arabidopsis hit)

MNIISGSIPKCLTNLTTLAQKGNSSLNISHSYEISTINLVDFYDDDATFMWKGGMQTYKSTLGLVKRIDLSSNKLTGEIPSEITHLVGLVSLNLSRNQLTGQITPKIGNLQSLDSLDLSRNHIDGRIPTSLARIDRLGFLDLSYNNLSGKIPVGTQLQGFDPSFYAGNLQLCGPPLKKMCADEVEKGQSEQTDFINQEDKDELITPGFYISMGLGFAAGFWGVCGTLIFSRSWRYTYLKFLNDLNDWLFVRIALLKRQLRDA*


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
2-180 L domain-like,LRR

NIISGSIPKCLTNLTTLAQKGNSSLNISHSYEISTINLVDFYDDDATFMWKGGMQTYKSTLGLVKRIDLSSNKLTGEIPSEITHLVGLVSLNLSRNQLTGQITPKIGNLQSLDSLDLSRNHIDGRIPTSLARIDRLGFLDLSYNNLSGKIPVGTQLQGFDPSFYAGNLQLCGPPLKKMC

HMMPfam: PF00560
IPR001611
66-86 LRR_1
Leucine-rich repeat

KRIDLSSNKLTGEIPSEITHL

Gene3D: G3DSA:3.80.10.10
67-178 no description

RIDLSSNKLTGEIPSEITHLVGLVSLNLSRNQLTGQITPKIGNLQSLDSLDLSRNHIDGRIPTSLARIDRLGFLDLSYNNLSGKIPVGTQLQGFDPSFYAGNLQLCGPPLKK

HMMPanther: PTHR26393:SF516
68-261 OS10G0120300 PROTEIN (FRAGMENT)

IDLSSNKLTGEIPSEITHLVGLVSLNLSRNQLTGQITPKIGNLQSLDSLDLSRNHIDGRIPTSLARIDRLGFLDLSYNNLSGKIPVGTQLQGFDPSFYAGNLQLCGPPLKKMCADEVEKGQSEQTDFINQEDKDELITPGFYISMGLGFAAGFWGVCGTLIFSRSWRYTYLKFLNDLNDWLFVRIALLKRQLRD

HMMPanther: PTHR26393
68-261 FAMILY NOT NAMED,FAMILY NOT NAMED

IDLSSNKLTGEIPSEITHLVGLVSLNLSRNQLTGQITPKIGNLQSLDSLDLSRNHIDGRIPTSLARIDRLGFLDLSYNNLSGKIPVGTQLQGFDPSFYAGNLQLCGPPLKKMCADEVEKGQSEQTDFINQEDKDELITPGFYISMGLGFAAGFWGVCGTLIFSRSWRYTYLKFLNDLNDWLFVRIALLKRQLRD

FPrintScan: PR00019
89-102 LEURICHRPT,Leucine-rich repeat signature

LVSLNLSRNQLTGQ

HMMPfam: PF12799
89-124 LRR_4,Leucine Rich repeats (2 copies)

LVSLNLSRNQLTGQITPKIGNLQSLDSLDLSRNHID

FPrintScan: PR00019
110-123 LEURICHRPT,Leucine-rich repeat signature

LQSLDSLDLSRNHI

HMMPfam: PF00560
IPR001611
139-153 LRR_1
Leucine-rich repeat

FLDLSYNNLSGKIPV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox