PRGDB00172562 (ppa023693m)

From PRG Wiki
Jump to: navigation, search
ppa023693m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich receptor-like protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGTCTTCTTCTCTTGTTCCGATGAAACACGACAAGAAGAAGCAGAAGTGGGTTTTCATTCTTCTTCTTCTTCCTTGCTCTGCTTCTGCTGCTTGTAACCAGCTCGATCAGGACGCTCTATTGTCCTTGGCTCTCCAGGCACCATTGAATTTGAATTGGTCTTCTTCCACTGACTGTTGCCTTTGGGAAGGAATAACCTGCGGCCCAGATGATCAAGGACGTGTCGTCCGGCTATGGCTGCCTAGGAGAGGCTTAACTGGTGTCATCAATTCATCAATCACAAACCTCACCCATCTCACCCACCTCAATCTTTCCCACAATTCTTTCCCGGGTTTTCTCCCTGAAGATTTGTTTTCATCTCTCTCTAGTCTCCAAGTCATTGACTTGAGCTTCAATCGTCTCATTGGCCGTCTACCACCTTCAAATAAAATCAGTCAGCTTCAGGTTCTGAACTTGTCTAGCAATTTCTTCAATGGAACAATCCCATCTTCGATCCTTGCCCCATCGGTGTCCATTTTCAATGTCAGCAACAACAGCTTTTCCGGGTCGATACCCATCGACAATGGTAGCAACCACACATCCCTTACCTTCTTGGACTTGTCCTACAACAAACTCAATGACACAATTCCCCCTGGAATCGGATTATGTTCCAAGCTCCAAGTTTTCCGTGCAGGCTTCAATAGCCTCTCTGGTTCTCTCCCTGATGAAATTTTCAACCTTGCTGATCTCCGACAGCTCTCTCTGCCTGTCAATAGTCTTACAGGACCCATCAACGATGGTATCATGAACCTCACCAATCTCCAGATCCTGGAGATCTTTTCAAACCAGTTCTCTGGGCCAATCCCCAGCCAAATTGGTAGCCTTTCCAGGTTGGAAAATCTGCTGCTCCACGACAACAACCTCACAGGCCCCTTACCTCTATCTCTCGCCAACAGTACAAAGCTGTCTGCTTTGAATTTGAGGGTCAACAACTTGACTGGAGACCTCTCTTCCTTCAACTTCTCCCCTCTCCAACGCCTCACCACTCTGGACCTTGGCAACAACAACTTCACTGGTGAGTTCCCCAAAAGCCTCTACTCTTGCAAGTCACTAACAGCTATTAGATTGGCCGGGAATCAGCTCACAGGTCAGATATCACCTGAAATAGTTGCATTAGAATCCTTGGCTTTCCTCTCCGTCTCTACCAACAACATGACAAATGCCACTGGGGCTCTTAGGATTCTAAAGGGTTGCAAGAACCTGACCACTCTGATCTTGTCCAATAATTTTCTGTTTGAGCCTGTGCCAGATGATAAAAGCCTAGGAGACCTAGATGGATTCCAAAGCCTTCGGGTTTTTTCTCTTGGGGGTTGCCAATTCACAGGTCAAGTACCCACCTGGCTAGCCAAGCTTAAAAACCTTCAAGCCTTGGACCTGTCATTTAATCTTATAACTGGTTCTCTTCCCGGTTGGTTGGCTAGTCTGCCCAACCTTTTCTACATTGATTTGTCCAATAACCTCCTTCAAGGCGGATTTCCTAATGACCTCTGTGGGATGCCAGTTTTGACATCGAAAGAGGCCAGTGATAAGGTGGACAGAAGTTATTTAGAGTTGCCACTATTTGTGAGGCCCAATAATGCTACTGATCAGCAGTACAACCAACTGTCCAACCTCCCCCCAGCCATATATTTGAGTAACAACAGCCTTAATGGCAGTATCCCCATTGAGATTGGCCGATTGAAGTTTATTCATGTGTTGGACCTTAGTCATAACAAATTCTCTGGCAGCATCCCAGATCAGATTTCTAACCTCACTAACTTAGAGAAATTGGATCTTTCCTATAACAATCTATCCGGTGAAATCCCTGTTTCTCTCAAAGGTCTGCATTTCTTGTCTTCCTTCAGTGTGGCATACAATGATCTTCAGGGACTTGTACCATCTGGAGGTCAGTTTGATACTTTTACCATGTCCAGCTTTGAAGGGAATCCGGGCTTATGTGGTCCTCCAACTGTGCATCGCACATGTCCTCAACCATTATCACCGGCTGCTTCTCGAAGGTCTAACAAAAATCTTCTTATTGGACTCACCTCTGGGATCTGTTTTGGCATTGTATTTATTGTTGTTATGCTAGTAGTGTGGATGTTGTCTAAGAGAAGGATCATTCCAGGAGGAGATACTGACAAGATGGATTTTGACACAATGTCTAGCCATTCAGCCACTGCTGTTACTCCTGAGCTTGACAAGGATACCAGCCTAGTCATAGTGTTCCCAACCAATACCAATGAAATCAAGGATCTTACTATAACTGAAATCTTAAAGGCAACTGACGATTTCAATCAAGCAAACATCATTGGCTGTGGAGGTTTTGGTCTGGTTTACAGAGCAACATTCCCAAATGGGACCAGGCTAGCTGTTAAGAAACTCTCAGGAGACTTGGGTCTGATGGAAAGGGAATTCAAAGCAGAAGTTGAGGCTTTGTCCACTGCCCAACATGAGAATCTTGTTTCTCTGCAAGGCTATTGTGTGCATGATGGTGTTCGCCTGTTAATATATTCCTATATGGAGAATGGAAGTCTGGATTACTGGTTGCATGAGAAAGCTGATGGTGCTTCCCAGTTAGATTGGCAAACTCGACTGAAGATAGCACAGGGAGCAGGCTGCGGGTTGGCTTACATGCACCAAATATGTGAGCCACACATTGTGCATCGTGATATCAAGTCCAGCAACATCCTCCTGGATGATAAATTTCAAGCACATGTTGCTGATTTTGGGTTGTCCCGGTTGATTCTTCCGTACCAGACTCATGTTACAACTGAGCTTGTTGGTACCCTTGGTTACATTCCTCCAGAGTATGGACAAGCATGGGTGGCCACATTGAGAGGAGATATGTACAGTTTTGGGGTTGTCATGCTTGAGCTGCTAACCGGAAAAAGGCCTTTCGAGGTATGCAAGCCAAGGGCATCGAGAGAGTTGGTTGGCTGGGTGCAGCAAATGAGGAGAGAGGGCAAACCAGAGGAAGTTTTTGATCCTCTCCTGAGAGGGAAGGGCTTTGACGAAGAGATGCTGCAGGTGCTTGACGTGGCTTGCATGTGTGTCAACCAGAACCCTCTTAAGAGACCAACCATCAAGGAAGTTGTCGATTGGCTGAAAAAT


Protein sequences

Name Description Sequence
ppa023693m Leucine-rich receptor-like protein kinase family protein (best arabidopsis hit)

MSSSLVPMKHDKKKQKWVFILLLLPCSASAACNQLDQDALLSLALQAPLNLNWSSSTDCCLWEGITCGPDDQGRVVRLWLPRRGLTGVINSSITNLTHLTHLNLSHNSFPGFLPEDLFSSLSSLQVIDLSFNRLIGRLPPSNKISQLQVLNLSSNFFNGTIPSSILAPSVSIFNVSNNSFSGSIPIDNGSNHTSLTFLDLSYNKLNDTIPPGIGLCSKLQVFRAGFNSLSGSLPDEIFNLADLRQLSLPVNSLTGPINDGIMNLTNLQILEIFSNQFSGPIPSQIGSLSRLENLLLHDNNLTGPLPLSLANSTKLSALNLRVNNLTGDLSSFNFSPLQRLTTLDLGNNNFTGEFPKSLYSCKSLTAIRLAGNQLTGQISPEIVALESLAFLSVSTNNMTNATGALRILKGCKNLTTLILSNNFLFEPVPDDKSLGDLDGFQSLRVFSLGGCQFTGQVPTWLAKLKNLQALDLSFNLITGSLPGWLASLPNLFYIDLSNNLLQGGFPNDLCGMPVLTSKEASDKVDRSYLELPLFVRPNNATDQQYNQLSNLPPAIYLSNNSLNGSIPIEIGRLKFIHVLDLSHNKFSGSIPDQISNLTNLEKLDLSYNNLSGEIPVSLKGLHFLSSFSVAYNDLQGLVPSGGQFDTFTMSSFEGNPGLCGPPTVHRTCPQPLSPAASRRSNKNLLIGLTSGICFGIVFIVVMLVVWMLSKRRIIPGGDTDKMDFDTMSSHSATAVTPELDKDTSLVIVFPTNTNEIKDLTITEILKATDDFNQANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYMENGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVVDWLKN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
2-1044 FAMILY NOT NAMED,FAMILY NOT NAMED

SSSLVPMKHDKKKQKWVFILLLLPCSASAACNQLDQDALLSLALQAPLNLNWSSSTDCCLWEGITCGPDDQGRVVRLWLPRRGLTGVINSSITNLTHLTHLNLSHNSFPGFLPEDLFSSLSSLQVIDLSFNRLIGRLPPSNKISQLQVLNLSSNFFNGTIPSSILAPSVSIFNVSNNSFSGSIPIDNGSNHTSLTFLDLSYNKLNDTIPPGIGLCSKLQVFRAGFNSLSGSLPDEIFNLADLRQLSLPVNSLTGPINDGIMNLTNLQILEIFSNQFSGPIPSQIGSLSRLENLLLHDNNLTGPLPLSLANSTKLSALNLRVNNLTGDLSSFNFSPLQRLTTLDLGNNNFTGEFPKSLYSCKSLTAIRLAGNQLTGQISPEIVALESLAFLSVSTNNMTNATGALRILKGCKNLTTLILSNNFLFEPVPDDKSLGDLDGFQSLRVFSLGGCQFTGQVPTWLAKLKNLQALDLSFNLITGSLPGWLASLPNLFYIDLSNNLLQGGFPNDLCGMPVLTSKEASDKVDRSYLELPLFVRPNNATDQQYNQLSNLPPAIYLSNNSLNGSIPIEIGRLKFIHVLDLSHNKFSGSIPDQISNLTNLEKLDLSYNNLSGEIPVSLKGLHFLSSFSVAYNDLQGLVPSGGQFDTFTMSSFEGNPGLCGPPTVHRTCPQPLSPAASRRSNKNLLIGLTSGICFGIVFIVVMLVVWMLSKRRIIPGGDTDKMDFDTMSSHSATAVTPELDKDTSLVIVFPTNTNEIKDLTITEILKATDDFNQANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYMENGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVVDWLKN

HMMPanther: PTHR24420:SF478
2-1044 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SSSLVPMKHDKKKQKWVFILLLLPCSASAACNQLDQDALLSLALQAPLNLNWSSSTDCCLWEGITCGPDDQGRVVRLWLPRRGLTGVINSSITNLTHLTHLNLSHNSFPGFLPEDLFSSLSSLQVIDLSFNRLIGRLPPSNKISQLQVLNLSSNFFNGTIPSSILAPSVSIFNVSNNSFSGSIPIDNGSNHTSLTFLDLSYNKLNDTIPPGIGLCSKLQVFRAGFNSLSGSLPDEIFNLADLRQLSLPVNSLTGPINDGIMNLTNLQILEIFSNQFSGPIPSQIGSLSRLENLLLHDNNLTGPLPLSLANSTKLSALNLRVNNLTGDLSSFNFSPLQRLTTLDLGNNNFTGEFPKSLYSCKSLTAIRLAGNQLTGQISPEIVALESLAFLSVSTNNMTNATGALRILKGCKNLTTLILSNNFLFEPVPDDKSLGDLDGFQSLRVFSLGGCQFTGQVPTWLAKLKNLQALDLSFNLITGSLPGWLASLPNLFYIDLSNNLLQGGFPNDLCGMPVLTSKEASDKVDRSYLELPLFVRPNNATDQQYNQLSNLPPAIYLSNNSLNGSIPIEIGRLKFIHVLDLSHNKFSGSIPDQISNLTNLEKLDLSYNNLSGEIPVSLKGLHFLSSFSVAYNDLQGLVPSGGQFDTFTMSSFEGNPGLCGPPTVHRTCPQPLSPAASRRSNKNLLIGLTSGICFGIVFIVVMLVVWMLSKRRIIPGGDTDKMDFDTMSSHSATAVTPELDKDTSLVIVFPTNTNEIKDLTITEILKATDDFNQANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYMENGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVVDWLKN

Seg: seg
21-24 seg

LLLL

Seg: seg
33-52 seg

NQLDQDALLSLALQAPLNLN

HMMPfam: PF08263
IPR013210
37-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QDALLSLALQAPLNLNWSSSTDCCLWEGITC

Gene3D: G3DSA:3.80.10.10
46-265 no description

QAPLNLNWSSSTDCCLWEGITCGPDDQGRVVRLWLPRRGLTGVINSSITNLTHLTHLNLSHNSFPGFLPEDLFSSLSSLQVIDLSFNRLIGRLPPSNKISQLQVLNLSSNFFNGTIPSSILAPSVSIFNVSNNSFSGSIPIDNGSNHTSLTFLDLSYNKLNDTIPPGIGLCSKLQVFRAGFNSLSGSLPDEIFNLADLRQLSLPVNSLTGPINDGIMNLT

superfamily: SSF52047
77-399 RNI-like,LRR

RLWLPRRGLTGVINSSITNLTHLTHLNLSHNSFPGFLPEDLFSSLSSLQVIDLSFNRLIGRLPPSNKISQLQVLNLSSNFFNGTIPSSILAPSVSIFNVSNNSFSGSIPIDNGSNHTSLTFLDLSYNKLNDTIPPGIGLCSKLQVFRAGFNSLSGSLPDEIFNLADLRQLSLPVNSLTGPINDGIMNLTNLQILEIFSNQFSGPIPSQIGSLSRLENLLLHDNNLTGPLPLSLANSTKLSALNLRVNNLTGDLSSFNFSPLQRLTTLDLGNNNFTGEFPKSLYSCKSLTAIRLAGNQLTGQISPEIVALESLAFLSVSTNNMT

HMMPfam: PF13855
77-134 LRR_8,Leucine rich repeat

RLWLPRRGLTGVINSSITNLTHLTHLNLSHNSFPGFLPEDLFSSLSSLQVIDLSFNRL

Seg: seg
91-108 seg

SSITNLTHLTHLNLSHNS

HMMSmart: SM00369
IPR003591
96-120 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTHLTHLNLSHNSFPGFLPEDLFSS

ProfileScan: PS51450
IPR001611
98-119 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTHLNLSHNSFPGFLPEDLFS

HMMSmart: SM00369
IPR003591
121-143 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLQVIDLSFNRLIGRLPPSNK

ProfileScan: PS51450
IPR001611
123-145 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQVIDLSFNRLIGRLPPSNKIS

HMMSmart: SM00369
IPR003591
144-168 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

ISQLQVLNLSSNFFNGTIPSSILAP

ProfileScan: PS51450
IPR001611
146-168 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQVLNLSSNFFNGTIPSSILAP

HMMPfam: PF00560
IPR001611
146-166 LRR_1
Leucine-rich repeat

QLQVLNLSSNFFNGTIPSSIL

Seg: seg
169-184 seg

SVSIFNVSNNSFSGSI

HMMSmart: SM00369
IPR003591
193-216 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

TSLTFLDLSYNKLNDTIPPGIGLC

HMMPfam: PF00560
IPR001611
194-213 LRR_1
Leucine-rich repeat

SLTFLDLSYNKLNDTIPPGI

ProfileScan: PS51450
IPR001611
194-216 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTFLDLSYNKLNDTIPPGIGLC

FPrintScan: PR00019
195-208 LEURICHRPT,Leucine-rich repeat signature

LTFLDLSYNKLNDT

Gene3D: G3DSA:3.80.10.10
266-376 no description

NLQILEIFSNQFSGPIPSQIGSLSRLENLLLHDNNLTGPLPLSLANSTKLSALNLRVNNLTGDLSSFNFSPLQRLTTLDLGNNNFTGEFPKSLYSCKSLTAIRLAGNQLTG

superfamily: SSF52058
281-656 L domain-like,LRR

IPSQIGSLSRLENLLLHDNNLTGPLPLSLANSTKLSALNLRVNNLTGDLSSFNFSPLQRLTTLDLGNNNFTGEFPKSLYSCKSLTAIRLAGNQLTGQISPEIVALESLAFLSVSTNNMTNATGALRILKGCKNLTTLILSNNFLFEPVPDDKSLGDLDGFQSLRVFSLGGCQFTGQVPTWLAKLKNLQALDLSFNLITGSLPGWLASLPNLFYIDLSNNLLQGGFPNDLCGMPVLTSKEASDKVDRSYLELPLFVRPNNATDQQYNQLSNLPPAIYLSNNSLNGSIPIEIGRLKFIHVLDLSHNKFSGSIPDQISNLTNLEKLDLSYNNLSGEIPVSLKGLHFLSSFSVAYNDLQGLVPSGGQFDTFTMSSFEGNP

ProfileScan: PS51450
IPR001611
290-311 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLENLLLHDNNLTGPLPLSLAN

ProfileScan: PS51450
IPR001611
314-336 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLSALNLRVNNLTGDLSSFNFSP

HMMSmart: SM00369
IPR003591
337-361 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQRLTTLDLGNNNFTGEFPKSLYSC

HMMPfam: PF13516
337-358 LRR_6,Leucine Rich repeat

LQRLTTLDLGNNNFTGEFPKSL

ProfileScan: PS51450
IPR001611
339-361 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTTLDLGNNNFTGEFPKSLYSC

HMMPfam: PF13516
411-424 LRR_6,Leucine Rich repeat

CKNLTTLILSNNFL

ProfileScan: PS51450
IPR001611
413-435 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTTLILSNNFLFEPVPDDKSLG

HMMPfam: PF13855
442-501 LRR_8,Leucine rich repeat

SLRVFSLGGCQFTGQVPTWLAKLKNLQALDLSFNLITGSLPGWLASLPNLFYIDLSNNLL

HMMSmart: SM00369
IPR003591
464-487 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLQALDLSFNLITGSLPGWLAS

ProfileScan: PS51450
IPR001611
466-489 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQALDLSFNLITGSLPGWLASLP

HMMSmart: SM00369
IPR003591
488-512 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLFYIDLSNNLLQGGFPNDLCGM

ProfileScan: PS51450
IPR001611
490-511 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLFYIDLSNNLLQGGFPNDLCG

Gene3D: G3DSA:3.80.10.10
554-663 no description

AIYLSNNSLNGSIPIEIGRLKFIHVLDLSHNKFSGSIPDQISNLTNLEKLDLSYNNLSGEIPVSLKGLHFLSSFSVAYNDLQGLVPSGGQFDTFTMSSFEGNPGLCGPPT

ProfileScan: PS51450
IPR001611
575-598 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FIHVLDLSHNKFSGSIPDQISNLT

HMMPfam: PF12799
577-611 LRR_4,Leucine Rich repeats (2 copies)

HVLDLSHNKFSGSIPDQISNLTNLEKLDLSYNNLS

FPrintScan: PR00019
597-610 LEURICHRPT,Leucine-rich repeat signature

LTNLEKLDLSYNNL

HMMSmart: SM00369
IPR003591
597-620 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLEKLDLSYNNLSGEIPVSLKG

ProfileScan: PS51450
IPR001611
599-622 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEKLDLSYNNLSGEIPVSLKGLH

superfamily: SSF56112
IPR011009
741-1042 Protein kinase-like (PK-like)
Protein kinase-like domain

KDTSLVIVFPTNTNEIKDLTITEILKATDDFNQANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYMENGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVVDWL

Gene3D: G3DSA:3.30.200.20
752-847 no description

NTNEIKDLTITEILKATDDFNQANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYM

HMMSmart: SM00220
IPR002290
771-1042 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNQANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYMENGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVVDWL

HMMSmart: SM00219
IPR020635
771-1042 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNQANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYMENGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVVDWL

ProfileScan: PS50011
IPR000719
771-1044 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNQANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYMENGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVVDWLKN

HMMPfam: PF00069
IPR000719
773-1039 Pkinase,Ser-thr
Protein kinase, catalytic domain

QANIIGCGGFGLVYRATFPNGTRLAVKKLSGDLGLMEREFKAEVEALSTAQHENLVSLQGYCVHDGVRLLIYSYMENGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVV

PatternScan: PS00107
IPR017441
777-800 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGCGGFGLVYRATFPNGTRLAVKK

Gene3D: G3DSA:1.10.510.10
849-1042 no description

NGSLDYWLHEKADGASQLDWQTRLKIAQGAGCGLAYMHQICEPHIVHRDIKSSNILLDDKFQAHVADFGLSRLILPYQTHVTTELVGTLGYIPPEYGQAWVATLRGDMYSFGVVMLELLTGKRPFEVCKPRASRELVGWVQQMRREGKPEEVFDPLLRGKGFDEEMLQVLDVACMCVNQNPLKRPTIKEVVDWL

PatternScan: PS00108
IPR008271
893-905 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox