PRGDB00172564 (ppa018964m)

From PRG Wiki
Jump to: navigation, search
ppa018964m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

DNA Sequence

ATGTGCACTATCTTAAAGCAATTTATTCAGCAAAGAAAAGTCTCTTCTTCTCCTTCTTCTTCTTCTTTCACTCATGATTCATCATGGATATATGATGTGTTTTTGAGTTTTAGAGGTGAAGATACACGCACCAATTTTACAGATCATTTGCACGAGGCTTTAGTCCGTAAGGGAATCCGAACCTTCATTGATCGAGAGCTTGTAAGAGGAGAAGAAATATCGCCAGCCCTTGTCAGAGCAATTGAAGAATCAAGAATTTCTCTCATTGTATTCTCTGAAAACTATCCATCTTCGAGATGGTGCTTGGATGAACTTGTCAAGATCCTTCAATGTAAAGAATCAAAGCAACAAATAGTTTTGCCCATTTTTTACAAGGTGGATCCGTCGGATGTACGAAAGCAAACAAATAGTTTTGGAGATGCATTTAAAGGCCTTATTCAAAGCAAATTCAAGGATGACAAGGAGAAAGTGCTCATATGGAAGGAAGCTCTTAGACAAGCAGCAAATTTGTCCGGACATACTTTCAAACATGGAGAGTATGAAGCTACATTTATCAACAACATTGTTGATGGAATCTTAATCCAAGTACTGAGCAGCACATATTGGAATGTGGCCAAGTACCCAGTTGAAATTCAGTCTCATGTACAAGATGTGAAAAAGCTTTTAGATGTTGGTGGGAATGGTCGTCGCATGGTTGGGATATGGGGGACATCTGGAATAGGCAAGACAACAATTGCAAAAGCTATATGGAATGCAATTGCCCATGAGTTTGAAGGAAGTTGTTTCTTGCCAAATGTCAGGGAAAATTCAATGCCACATGGAGGCTTAATCAAGCTACAGAAGACTCTTCTTCATAAGTATCTAGGCAACAAGTTGAAAATTCAGAGTGTTGATGAAGGAATCGGTGTTATAAAAGAACGGCTGAGGCATAAAAAGATTCTATTAATTCTTGACGATGTGGACCACTTGGAGCAGTTAGAAAACTTGGCTGGAGATGATTGGTTTGGTGAGGGTAGTAGAGTAATCATTACTACAAAAAATAGGGGATTGCTAGAAAATCATGGGATTGAGTTGATATACAAGGTGAAGAAGTTAGATTACAACCAAGCTCTTGAGCTTTTCAGTTGGCATGCATTCGGAAGGAGTGAACCTCCAAAAGATTATTTGGAACTCGCACAACGTGTAATAGCTTTTGCCGATGGCCTTCCACTAGCTCTAACAATTTTAGGTTCTCATCTTCGTAATAGAAGTATTGGAAGTTGGCAAGTTATATTAGATGGTTACAAAGGAGAACCTTATACGCATATTGAAAGAATACTTCAAAAAAGTTATGATGCCTTGGATGATGACGCGAAAGAAGTTTTTCTCGACATTGCATGTTTCTTCAAGGATGCAAGTAAGGACGTTGTGCTACAAATAGTCCCTAAAAATTGCATTGAAGTACTAGTTGATAAGGCAATGATAACTGTTGAATGGGATCAGAGGATTTTAATGCACGACTTGCTACAAAAACTGGGCAAGGATATAGTTCACAAAGAATCCCCCAATGATCCCGGCAAGCGTAGTAGATTGTGGTTTTACGAGGATGTCATACAAGTTCTAATGGAAAGTACTGGAACAAGAAAGATTAAAGGCATCATGGTGAAGCTTCCAGAACCAGCTGAGATAACTTTGAATCCAGAGTGCTTCCGTAATATGGTGAATCTTCAAATTTTCATAAACCATAATGCATCTCTATGTGGGGACATTAACTATCTGCCCAACGCGTTAAGATTTATTGATTGGCCTAATTGTCAATTACAATCTTTGCCATCCGAGTTTCATCCGGTACGTCTTGCTGTGTGCAATATGCCCGCGGGTCGTATCAAACGATTGGAGAAATTGAAGATTATGTCAAACCTGACATCAATGAATTTAAGTGGTTGTAAATTCTTAGAAAAAATTTCTGACTTATCCGGAATCCCAAACATAACGAACTTGAATCTAAGTGACTGTACAAATTTAGTTGAGATTGATGATTCTGTTGGACTCCTTGATAAACTTGTTCGATTGAATCTTGATGGATGCGGTAGGCTTACGAGGTTTGCAACAAGACTTAGATCGAACTCCCTGATGGAACTTTCCCTTGTTGGTTGCCGAAGGCTTGAGAGTTTCCCAGAAATAGAGATGGAATCACTATTTAGTTTGGACATGGAAGGAAGTGGCGTAAGAAAATTCCCTTCATCAATTAGCAAATGTTTCAACTTGCGTATGCTTAAATTGCGTCGTTGCAAGAATCTTCTGGAAATTCCAGAACAAGCGCTTCCACCAACATTAACTTATGTAGTCATTGATTGCTGCCCATCATTGGAAAAAATTCCAAAAGTACTACGAGGCAACGACATCACAGAAAATATTTTTCTGAATCTGGTTTCTGTTTCTCATTTCGACATTCGTCTTCCAGGCGATGAAGTTCCAAAGTGGTTCAGCTGTCGTAAAGATGGAACAACAGTTAGACCTTATTTTTTTACAGGTCCTGGAACAAAGAAATACAATGGTGGATGTGAAGTTAGTTTTGAAATTCCTCCAAATTTAAAATGGGAGATGTTAAGATTGGTTCTATGTGTTGCTGGTACTGGTGCTTATGCCAAGATTCTTGTCAATGGAAAACTCGTAAATTCGGATGAGTTTGGTACTGAATTATTTGATGATAGTCATGTGGGGTTCATATGTATTCCATTAATGAATCGTGAGTCAGGAGAACCACCGAGGTTGAAGCAGGGCAATATCTGTCAAGTTATATTTGGCTTGACAAGATTACGGCGGACACCCCTTAAAGTATCCTGCGGGGTCCACCTGTTAGGCCACCAGGTTGATGTCCGTGAGACTGATGGGACGCAGTGGTTGGCAGATTTGATGGCAGTTGACTATGATGATTATGAGCACCATGTTTACTATGATGATGATGACGACGACAATGTTGACGACGATGATGATGAGCACGATGTTGACGATGATGATGATAATGACGACGAT


Protein sequences

Name Description Sequence
ppa018964m disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

MCTILKQFIQQRKVSSSPSSSSFTHDSSWIYDVFLSFRGEDTRTNFTDHLHEALVRKGIRTFIDRELVRGEEISPALVRAIEESRISLIVFSENYPSSRWCLDELVKILQCKESKQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFKDDKEKVLIWKEALRQAANLSGHTFKHGEYEATFINNIVDGILIQVLSSTYWNVAKYPVEIQSHVQDVKKLLDVGGNGRRMVGIWGTSGIGKTTIAKAIWNAIAHEFEGSCFLPNVRENSMPHGGLIKLQKTLLHKYLGNKLKIQSVDEGIGVIKERLRHKKILLILDDVDHLEQLENLAGDDWFGEGSRVIITTKNRGLLENHGIELIYKVKKLDYNQALELFSWHAFGRSEPPKDYLELAQRVIAFADGLPLALTILGSHLRNRSIGSWQVILDGYKGEPYTHIERILQKSYDALDDDAKEVFLDIACFFKDASKDVVLQIVPKNCIEVLVDKAMITVEWDQRILMHDLLQKLGKDIVHKESPNDPGKRSRLWFYEDVIQVLMESTGTRKIKGIMVKLPEPAEITLNPECFRNMVNLQIFINHNASLCGDINYLPNALRFIDWPNCQLQSLPSEFHPVRLAVCNMPAGRIKRLEKLKIMSNLTSMNLSGCKFLEKISDLSGIPNITNLNLSDCTNLVEIDDSVGLLDKLVRLNLDGCGRLTRFATRLRSNSLMELSLVGCRRLESFPEIEMESLFSLDMEGSGVRKFPSSISKCFNLRMLKLRRCKNLLEIPEQALPPTLTYVVIDCCPSLEKIPKVLRGNDITENIFLNLVSVSHFDIRLPGDEVPKWFSCRKDGTTVRPYFFTGPGTKKYNGGCEVSFEIPPNLKWEMLRLVLCVAGTGAYAKILVNGKLVNSDEFGTELFDDSHVGFICIPLMNRESGEPPRLKQGNICQVIFGLTRLRRTPLKVSCGVHLLGHQVDVRETDGTQWLADLMAVDYDDYEHHVYYDDDDDDNVDDDDDEHDVDDDDDNDDD

Domains

Domain Start-End Description Sequence

Seg: seg
15-28 seg

SSSPSSSSFTHDSS

superfamily: SSF52200
IPR000157
19-173 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

SSSSFTHDSSWIYDVFLSFRGEDTRTNFTDHLHEALVRKGIRTFIDRELVRGEEISPALVRAIEESRISLIVFSENYPSSRWCLDELVKILQCKESKQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFKDDKEKVLIWKEALRQAANLSGH

Gene3D: G3DSA:3.40.50.10140
27-167 no description

SSWIYDVFLSFRGEDTRTNFTDHLHEALVRKGIRTFIDRELVRGEEISPALVRAIEESRISLIVFSENYPSSRWCLDELVKILQCKESKQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFKDDKEKVLIWKEALRQA

ProfileScan: PS50104
IPR000157
29-170 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WIYDVFLSFRGEDTRTNFTDHLHEALVRKGIRTFIDRELVRGEEISPALVRAIEESRISLIVFSENYPSSRWCLDELVKILQCKESKQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFKDDKEKVLIWKEALRQAANL

HMMSmart: SM00255
IPR000157
30-170 Toll
Toll/interleukin-1 receptor homology (TIR) domain

IYDVFLSFRGEDTRTNFTDHLHEALVRKGIRTFIDRELVRGEEISPALVRAIEESRISLIVFSENYPSSRWCLDELVKILQCKESKQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFKDDKEKVLIWKEALRQAANL

HMMPfam: PF01582
IPR000157
33-165 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRTNFTDHLHEALVRKGIRTFIDRELVRGEEISPALVRAIEESRISLIVFSENYPSSRWCLDELVKILQCKESKQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFKDDKEKVLIWKEALR

HMMPanther: PTHR11017:SF20
57-825 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KGIRTFIDRELVRGEEISPALVRAIEESRISLIVFSENYPSSRWCLDELVKILQCKESKQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFKDDKEKVLIWKEALRQAANLSGHTFKHGEYEATFINNIVDGILIQVLSSTYWNVAKYPVEIQSHVQDVKKLLDVGGNGRRMVGIWGTSGIGKTTIAKAIWNAIAHEFEGSCFLPNVRENSMPHGGLIKLQKTLLHKYLGNKLKIQSVDEGIGVIKERLRHKKILLILDDVDHLEQLENLAGDDWFGEGSRVIITTKNRGLLENHGIELIYKVKKLDYNQALELFSWHAFGRSEPPKDYLELAQRVIAFADGLPLALTILGSHLRNRSIGSWQVILDGYKGEPYTHIERILQKSYDALDDDAKEVFLDIACFFKDASKDVVLQIVPKNCIEVLVDKAMITVEWDQRILMHDLLQKLGKDIVHKESPNDPGKRSRLWFYEDVIQVLMESTGTRKIKGIMVKLPEPAEITLNPECFRNMVNLQIFINHNASLCGDINYLPNALRFIDWPNCQLQSLPSEFHPVRLAVCNMPAGRIKRLEKLKIMSNLTSMNLSGCKFLEKISDLSGIPNITNLNLSDCTNLVEIDDSVGLLDKLVRLNLDGCGRLTRFATRLRSNSLMELSLVGCRRLESFPEIEMESLFSLDMEGSGVRKFPSSISKCFNLRMLKLRRCKNLLEIPEQALPPTLTYVVIDCCPSLEKIPKVLRGNDITENIFLNLVSVSHFDIRLPGDEVPKWFSCR

HMMPanther: PTHR11017
57-825 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KGIRTFIDRELVRGEEISPALVRAIEESRISLIVFSENYPSSRWCLDELVKILQCKESKQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFKDDKEKVLIWKEALRQAANLSGHTFKHGEYEATFINNIVDGILIQVLSSTYWNVAKYPVEIQSHVQDVKKLLDVGGNGRRMVGIWGTSGIGKTTIAKAIWNAIAHEFEGSCFLPNVRENSMPHGGLIKLQKTLLHKYLGNKLKIQSVDEGIGVIKERLRHKKILLILDDVDHLEQLENLAGDDWFGEGSRVIITTKNRGLLENHGIELIYKVKKLDYNQALELFSWHAFGRSEPPKDYLELAQRVIAFADGLPLALTILGSHLRNRSIGSWQVILDGYKGEPYTHIERILQKSYDALDDDAKEVFLDIACFFKDASKDVVLQIVPKNCIEVLVDKAMITVEWDQRILMHDLLQKLGKDIVHKESPNDPGKRSRLWFYEDVIQVLMESTGTRKIKGIMVKLPEPAEITLNPECFRNMVNLQIFINHNASLCGDINYLPNALRFIDWPNCQLQSLPSEFHPVRLAVCNMPAGRIKRLEKLKIMSNLTSMNLSGCKFLEKISDLSGIPNITNLNLSDCTNLVEIDDSVGLLDKLVRLNLDGCGRLTRFATRLRSNSLMELSLVGCRRLESFPEIEMESLFSLDMEGSGVRKFPSSISKCFNLRMLKLRRCKNLLEIPEQALPPTLTYVVIDCCPSLEKIPKVLRGNDITENIFLNLVSVSHFDIRLPGDEVPKWFSCR

superfamily: SSF52540
191-436 P-loop containing nucleoside triphosphate hydrolases

GILIQVLSSTYWNVAKYPVEIQSHVQDVKKLLDVGGNGRRMVGIWGTSGIGKTTIAKAIWNAIAHEFEGSCFLPNVRENSMPHGGLIKLQKTLLHKYLGNKLKIQSVDEGIGVIKERLRHKKILLILDDVDHLEQLENLAGDDWFGEGSRVIITTKNRGLLENHGIELIYKVKKLDYNQALELFSWHAFGRSEPPKDYLELAQRVIAFADGLPLALTILGSHLRNRSIGSWQVILDGYKGEPYTHI

HMMPfam: PF00931
IPR002182
212-466 NB-ARC,NBS
NB-ARC

QSHVQDVKKLLDVGGNGRRMVGIWGTSGIGKTTIAKAIWNAIAHEFEGSCFLPNVRENSMPHGGLIKLQKTLLHKYLGNKLKIQSVDEGIGVIKERLRHKKILLILDDVDHLEQLENLAGDDWFGEGSRVIITTKNRGLLENHGIELIYKVKKLDYNQALELFSWHAFGRSEPPKDYLELAQRVIAFADGLPLALTILGSHLRNRSIGSWQVILDGYKGEPYTHIERILQKSYDALDDDAKEVFLDIACFFKDAS

Gene3D: G3DSA:3.40.50.300
216-354 no description

QDVKKLLDVGGNGRRMVGIWGTSGIGKTTIAKAIWNAIAHEFEGSCFLPNVRENSMPHGGLIKLQKTLLHKYLGNKLKIQSVDEGIGVIKERLRHKKILLILDDVDHLEQLENLAGDDWFGEGSRVIITTKNRGLLENH

HMMSmart: SM00382
IPR003593
228-365 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

GRRMVGIWGTSGIGKTTIAKAIWNAIAHEFEGSCFLPNVRENSMPHGGLIKLQKTLLHKYLGNKLKIQSVDEGIGVIKERLRHKKILLILDDVDHLEQLENLAGDDWFGEGSRVIITTKNRGLLENHGIELIYKVKKL

FPrintScan: PR00364
IPR000767
231-246 DISEASERSIST
Disease resistance protein

MVGIWGTSGIGKTTIA

FPrintScan: PR00364
IPR000767
307-321 DISEASERSIST
Disease resistance protein

RLRHKKILLILDDVD

FPrintScan: PR00364
IPR000767
399-413 DISEASERSIST
Disease resistance protein

ADGLPLALTILGSHL

superfamily: SSF52058
509-812 L domain-like,LRR

IVHKESPNDPGKRSRLWFYEDVIQVLMESTGTRKIKGIMVKLPEPAEITLNPECFRNMVNLQIFINHNASLCGDINYLPNALRFIDWPNCQLQSLPSEFHPVRLAVCNMPAGRIKRLEKLKIMSNLTSMNLSGCKFLEKISDLSGIPNITNLNLSDCTNLVEIDDSVGLLDKLVRLNLDGCGRLTRFATRLRSNSLMELSLVGCRRLESFPEIEMESLFSLDMEGSGVRKFPSSISKCFNLRMLKLRRCKNLLEIPEQALPPTLTYVVIDCCPSLEKIPKVLRGNDITENIFLNLVSVSHFDIR

Gene3D: G3DSA:3.80.10.10
558-787 no description

LNPECFRNMVNLQIFINHNASLCGDINYLPNALRFIDWPNCQLQSLPSEFHPVRLAVCNMPAGRIKRLEKLKIMSNLTSMNLSGCKFLEKISDLSGIPNITNLNLSDCTNLVEIDDSVGLLDKLVRLNLDGCGRLTRFATRLRSNSLMELSLVGCRRLESFPEIEMESLFSLDMEGSGVRKFPSSISKCFNLRMLKLRRCKNLLEIPEQALPPTLTYVVIDCCPSLEKIP

FPrintScan: PR00364
IPR000767
629-645 DISEASERSIST
Disease resistance protein

KIMSNLTSMNLSGCKFL

Seg: seg
968-1005 seg

VDYDDYEHHVYYDDDDDDNVDDDDDEHDVDDDDDNDDD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox