PRGDB00172569 (ppa007850m)

From PRG Wiki
Jump to: navigation, search
ppa007850m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

MAP kinase kinase 5 (best arabidopsis hit)

DNA Sequence

ATGAATCGGATTCAACCACCGCTGGGAGCGAACCCGCCGCCCGCCAGGCGTGGGGACAACCCGAGACGACGTCGTCACGACCTAACCCTACCTCTCCCGCAGCGGGACGCGTCCCTCGCCGTGCCCTTGCCCCTTCCTCCGCCCGGACCCAGCTCGGCCCAATCGTCCTCGGCCCACAGCGCCGCCCAGCAGCTCATCAACTTCAACGAGCTCGAGCGCTCGAACCGCATCGGGAGCGGAACCGGAGGCACCGTCTACAAGGTCATCCACCGCCCGACGGGTCGTCTGTACGCGCTGAAAGTCATATACGGCAACCACGAGGAAGCCGTCCGCCGCCAGATCTGCCGCGAGATCGAAATCCTCCGCGGCGTCGACAACCCCAACGTTGTCAAGTGCCACGACATGTTCGACCACAACGGCGAGATCGAGGTGCTGCTCGAGTTAATGGACGGCGGGTCGCTGGAGGGCCAGCTCATCCAGAACGAGAAGACCCTCTCCGATTTGGCCAAGCAAATCTTGAGCGGCCTCGCCTACCTCCATAGACGTAAGATCGTGCATCGCGATATCAAGCCCTCGAATCTCTTGATCAACGCCAGGAACCAGGTCAAGATCGCCGATTTTGGGGTCAGTCGGATTTTGGAACAGACCATGGACCCTTGCAATTCTTCTGTGGGCACCATAGCTTATATGAGCCCTGAGAGGATCAATACTGATCTCAATCATGGCCAGTATGATGGGTATGCCGGTGATATATGGAGCCTTGGGGTCAGCATATTGGAATTCTACATGGGTCGGTTTCCGTTCTCTGTGGGAAGGTCAGGGGATTGGGCTAGCTTAATGTGGGCTATCTGTATGTCTCAGCCTCCTGAAGCTCCGCCCACTGCTTCGAGAGAGTTCAGGCATTTTATCTCTTGCTGTTTGCAGAGAGATCCTTCGAGGAGATTGTCGGCGGTGCAGTTGTTGCAGCATCCTTTTATCTCCGGCAATGGCGGCGGTCAGGCCCAGCAAGCACATCAGAATCTTCACCATCTTCTGCCACCACCCAGGCCTCTTCCTTCTTAA


Protein sequences

Name Description Sequence
ppa007850m MAP kinase kinase 5 (best arabidopsis hit)

MNRIQPPLGANPPPARRGDNPRRRRHDLTLPLPQRDASLAVPLPLPPPGPSSAQSSSAHSAAQQLINFNELERSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILSGLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFISGNGGGQAQQAHQNLHHLLPPPRPLPS*

Domains

Domain Start-End Description Sequence

Seg: seg
10-25 seg

ANPPPARRGDNPRRRR

HMMPanther: PTHR24361:SF31
11-352 SUBFAMILY NOT NAMED

NPPPARRGDNPRRRRHDLTLPLPQRDASLAVPLPLPPPGPSSAQSSSAHSAAQQLINFNELERSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILSGLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFISGNGGGQAQQAHQNLHHLLPPPRPLP

HMMPanther: PTHR24361
11-352 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

NPPPARRGDNPRRRRHDLTLPLPQRDASLAVPLPLPPPGPSSAQSSSAHSAAQQLINFNELERSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILSGLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFISGNGGGQAQQAHQNLHHLLPPPRPLP

Seg: seg
37-65 seg

ASLAVPLPLPPPGPSSAQSSSAHSAAQQL

Gene3D: G3DSA:3.30.200.20
50-174 no description

PSSAQSSSAHSAAQQLINFNELERSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILS

superfamily: SSF56112
IPR011009
57-353 Protein kinase-like (PK-like)
Protein kinase-like domain

SAHSAAQQLINFNELERSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILSGLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFISGNGGGQAQQAHQNLHHLLPPPRPLPS

HMMSmart: SM00220
IPR002290
71-326 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LERSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILSGLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFI

HMMSmart: SM00219
IPR020635
71-326 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LERSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILSGLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFI

ProfileScan: PS50011
IPR000719
71-326 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LERSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILSGLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFI

HMMPfam: PF00069
IPR000719
73-326 Pkinase,Ser-thr
Protein kinase, catalytic domain

RSNRIGSGTGGTVYKVIHRPTGRLYALKVIYGNHEEAVRRQICREIEILRGVDNPNVVKCHDMFDHNGEIEVLLELMDGGSLEGQLIQNEKTLSDLAKQILSGLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFI

PatternScan: PS00107
IPR017441
77-100 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGTGGTVYKVIHRPTGRLYALK

Gene3D: G3DSA:1.10.510.10
175-337 no description

GLAYLHRRKIVHRDIKPSNLLINARNQVKIADFGVSRILEQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYMGRFPFSVGRSGDWASLMWAICMSQPPEAPPTASREFRHFISCCLQRDPSRRLSAVQLLQHPFISGNGGGQAQQA

PatternScan: PS00108
IPR008271
184-196 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPSNLLI

Seg: seg
328-351 seg

GNGGGQAQQAHQNLHHLLPPPRPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox