PRGDB00172571 (ppa016492m)

From PRG Wiki
Jump to: navigation, search
ppa016492m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

receptor like protein 52 (best arabidopsis hit)

DNA Sequence

AACTTCAATAAGAGCCTCTTCGTTTTGGATCAACGGAAGAATAAATTTCATAGTGTGATTCCTAAGGCATTTTCTATGGGAAATGTTTTGAGAAATCTTGATCTTAATGGAAATCATTTGGAATGGCCGTTACCGTCATCTTTGCTCACATGTAGAGAGTTGGAATATTATCAGGACACTGTAGTAGTGGCAATTAAAGGCTTCAAAATTGAAATGCCGAAGATTCAGACTTTCTTCACAACTATTGATTTCTCAAACAACACTTTTATAGGAGAGATTCCAAACGTAAACAGTAGGCTTAAGTCATTAAAGGGGCTTAACTTTTCTCATAATGAGCTTACAAGTACAATTCCACCCTCGTTTGGTGATTTGAGCAATCTTGAATCAAATTTGACATCACTTGAAAAGTTCAACGTTTTAGAAAACCAACTTGTCAGACCCACACCTCATGGCAAGCAATTTGATACATTTGAAAATAATTTGTATAGTGGAAATGTCGAATTGTGTGGAAATGTCAAATGA


Protein sequences

Name Description Sequence
ppa016492m receptor like protein 52 (best arabidopsis hit)

NFNKSLFVLDQRKNKFHSVIPKAFSMGNVLRNLDLNGNHLEWPLPSSLLTCRELEYYQDTVVVAIKGFKIEMPKIQTFFTTIDFSNNTFIGEIPNVNSRLKSLKGLNFSHNELTSTIPPSFGDLSNLESNLTSLEKFNVLENQLVRPTPHGKQFDTFENNLYSGNVELCGNVK*


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
4-170 L domain-like,LRR

KSLFVLDQRKNKFHSVIPKAFSMGNVLRNLDLNGNHLEWPLPSSLLTCRELEYYQDTVVVAIKGFKIEMPKIQTFFTTIDFSNNTFIGEIPNVNSRLKSLKGLNFSHNELTSTIPPSFGDLSNLESNLTSLEKFNVLENQLVRPTPHGKQFDTFENNLYSGNVELCG

HMMPanther: PTHR24420
4-170 FAMILY NOT NAMED,FAMILY NOT NAMED

KSLFVLDQRKNKFHSVIPKAFSMGNVLRNLDLNGNHLEWPLPSSLLTCRELEYYQDTVVVAIKGFKIEMPKIQTFFTTIDFSNNTFIGEIPNVNSRLKSLKGLNFSHNELTSTIPPSFGDLSNLESNLTSLEKFNVLENQLVRPTPHGKQFDTFENNLYSGNVELCG

HMMPanther: PTHR24420:SF478
4-170 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KSLFVLDQRKNKFHSVIPKAFSMGNVLRNLDLNGNHLEWPLPSSLLTCRELEYYQDTVVVAIKGFKIEMPKIQTFFTTIDFSNNTFIGEIPNVNSRLKSLKGLNFSHNELTSTIPPSFGDLSNLESNLTSLEKFNVLENQLVRPTPHGKQFDTFENNLYSGNVELCG

Gene3D: G3DSA:3.80.10.10
4-169 no description

KSLFVLDQRKNKFHSVIPKAFSMGNVLRNLDLNGNHLEWPLPSSLLTCRELEYYQDTVVVAIKGFKIEMPKIQTFFTTIDFSNNTFIGEIPNVNSRLKSLKGLNFSHNELTSTIPPSFGDLSNLESNLTSLEKFNVLENQLVRPTPHGKQFDTFENNLYSGNVELC

HMMPfam: PF00560
IPR001611
30-48 LRR_1
Leucine-rich repeat

LRNLDLNGNHLEWPLPSSL

HMMPfam: PF00560
IPR001611
102-124 LRR_1
Leucine-rich repeat

SLKGLNFSHNELTSTIPPSFGDL

Seg: seg
124-135 seg

LSNLESNLTSLE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox