PRGDB00172586 (ppa015892m)

From PRG Wiki
Jump to: navigation, search
ppa015892m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Concanavalin A-like lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGTTGCTAATAACTTCGGGGACGGGATCATCCAACTCCACTCGCCAAAGCTTCTATCCTTCCTTCTGCTCTTGTTTCTGTTAAACCCTTCTGCAACTCCTTTAACCTTCAACTTCCCCAGCTTTTCCAATGGCACCACCAACATATCCCTAGAAGGAGATGCATATATTGATGGCAAATTCATCAAACTCACCAAAAAACCCGAAGAGCTTAAAGTGGCTGAGAATATCGGTCGAGCAACCTACCACAAACCGTTCCTTCTCCAGGAAAAAGCCACCGGAAAACTGGCCGATTTCACCACACATTTTACTTTCATCATTGATTCCGGCCACGGTGATGGGATGGTGTTCTTCCTAGCCCCAAATGGATCTTTAGTCAACATTGCAATAGGGGGTGGTGGCACACTTGGGCTCCCCGTTGAAGACTTGCCAGGAGGCATGTCTAGAACTCAGTATCCATTTGTGGCAGTGGAGTTTGATATCTTCCAGAATACACAGCCAAGCATCCAGGATCCCCCGAGCGATCATGTAGCAATCGACATCAACTCTCTCAAGTCTAATATTACCACGACTTGGAATGGTGGTATTGACAAAGCAAAACTAAACACCGCTTGGGTTAGTTATAACTCTAGCTCAAAAAATCTCAGTGTTGCCTTTACCAGTTTTCTAAATGGTACAAATGGCACCCAACTGGAGATAATCAGATATCTTTCTTACATGGTTGATCTGAAACAATACTTGCCGGATTGGGTCATTGTTGGATTCTCTACTGCAACGGGCAATGACATTGCTGTGCATAGGATCGTCTCGTGGAATTTCACATCAACAGCTCTGGTTGATGAGACTACAATGAACAACACACAAGTATTTCCTCCGCCAAGCCCTAGTGCTAATCCCAAGTCAGGAACTTCCAACATACGACTCCCCATTGGGTTGGGTGTTGGTGGATGTATTATCTTGGCTGGTGGATTGGCTTTGGTTTGGTTCATGTTCATTTTTCGGAAGAGAAAGGCAGTTGGGGAAAGTGATGAGAATCCTGTTGTCAACTGTTTAATTGACGATGAATTTGAAAAGGGAACTGGCCCGAGGAAGTTTTCATACAGGGACTTAGCTCGAGCAACGAATAATTTTCATGAGGGGGAGAAGCTGGGAGAGGGAGGATTTGGAGGGGTTTACATAGCCTTTATAAAAAACTTGAACTCATATGTTGCAATTAAGAGGATATCCAATGGATCTAAGCAAGGTTTGAAGGAGTATGCATCAGAAGTAAGAATTATCAGTAGACTTAGGCATCGGAATTTGGTGCAACTCATTGGTTGGTGCCATGAAAAAAGAGAACTACTACTCGTCTACGAGTTCATGCCCAACAGCAGTTTAGATTCCCACCTATTCAAAATAAATAGCTTGTTAAGTTGGCAAATCAGATACAAAATAGCTCGAGGTTTGGCCTCCGGCTTATTCTATCTACACGAAGAATGGGAACAATGTGTGCTGCACAGGGATATCAAATCCAGCAACGTTATGTTGGATTCAAATTTCAATGTGAAACTTGGTGATTTTGGATTAGCTCGACTTGTGGACCATGGAAAACAGTCACCAACAACAATTGTGGCTGGAACTAGAGGCTACATGGCTCTGGAATATGTTACTACAGGAAAGGCTAGCAAGGAATCAGATGTCTACAGCTTTGGAGTGGTTGCTTTGGAAATAGCTTGTGGGAGAAAACCGATCGATCTCAATTTAGAAAGTAGTGAAATCGAAATGGTGGAGTGGGTTTGGGAGCTTTATGGAGAAGGGAAAGTTATTCAAGCAGCCGATCCAAAACTCTATGGACAATTTGATGAGAATCAAATGGAGAGCTTGATGACTGTTGGGTTGTGGTGTGCTCACCCAGATTATAGATTCAGACCTTCAATACAACAAGCGATTCAAGTGCTTAACTGGGAAGTTCCATTGCCTATTCTCCCATCAAAGATGCCAGTTGCCACCTATTTTGCACCTCCAACATCACTTTCAATGTTGTCCAATCAAACTACTACTTCTGAAAGAGCCCAAATTTTGTCAGGATACAGTTATAGCACCAATTCCTCACAACTCACTGCATCTCCTACAACGCAGTTCTTGTCCATCGACACTGAAGCA


Protein sequences

Name Description Sequence
ppa015892m Concanavalin A-like lectin protein kinase family protein (best arabidopsis hit)

MVANNFGDGIIQLHSPKLLSFLLLLFLLNPSATPLTFNFPSFSNGTTNISLEGDAYIDGKFIKLTKKPEELKVAENIGRATYHKPFLLQEKATGKLADFTTHFTFIIDSGHGDGMVFFLAPNGSLVNIAIGGGGTLGLPVEDLPGGMSRTQYPFVAVEFDIFQNTQPSIQDPPSDHVAIDINSLKSNITTTWNGGIDKAKLNTAWVSYNSSSKNLSVAFTSFLNGTNGTQLEIIRYLSYMVDLKQYLPDWVIVGFSTATGNDIAVHRIVSWNFTSTALVDETTMNNTQVFPPPSPSANPKSGTSNIRLPIGLGVGGCIILAGGLALVWFMFIFRKRKAVGESDENPVVNCLIDDEFEKGTGPRKFSYRDLARATNNFHEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQAIQVLNWEVPLPILPSKMPVATYFAPPTSLSMLSNQTTTSERAQILSGYSYSTNSSQLTASPTTQFLSIDTEA

Domains

Domain Start-End Description Sequence

Seg: seg
18-28 seg

LLSFLLLLFLL

superfamily: SSF49899
IPR008985
32-280 Concanavalin A-like lectins/glucanases
Concanavalin A-like lectin/glucanase

ATPLTFNFPSFSNGTTNISLEGDAYIDGKFIKLTKKPEELKVAENIGRATYHKPFLLQEKATGKLADFTTHFTFIIDSGHGDGMVFFLAPNGSLVNIAIGGGGTLGLPVEDLPGGMSRTQYPFVAVEFDIFQNTQPSIQDPPSDHVAIDINSLKSNITTTWNGGIDKAKLNTAWVSYNSSSKNLSVAFTSFLNGTNGTQLEIIRYLSYMVDLKQYLPDWVIVGFSTATGNDIAVHRIVSWNFTSTALVD

Gene3D: G3DSA:2.60.120.200
IPR013320
34-286 no description
Concanavalin A-like lectin/glucanase, subgroup

PLTFNFPSFSNGTTNISLEGDAYIDGKFIKLTKKPEELKVAENIGRATYHKPFLLQEKATGKLADFTTHFTFIIDSGHGDGMVFFLAPNGSLVNIAIGGGGTLGLPVEDLPGGMSRTQYPFVAVEFDIFQNTQPSIQDPPSDHVAIDINSLKSNITTTWNGGIDKAKLNTAWVSYNSSSKNLSVAFTSFLNGTNGTQLEIIRYLSYMVDLKQYLPDWVIVGFSTATGNDIAVHRIVSWNFTSTALVDETTMNN

HMMPfam: PF00139
IPR001220
35-274 Lectin_legB
Legume lectin domain

LTFNFPSFSNGTTNISLEGDAYIDGKFIKLTKKPEELKVAENIGRATYHKPFLLQEKATGKLADFTTHFTFIIDSGHGDGMVFFLAPNGSLVNIAIGGGGTLGLPVEDLPGGMSRTQYPFVAVEFDIFQNTQPSIQDPPSDHVAIDINSLKSNITTTWNGGIDKAKLNTAWVSYNSSSKNLSVAFTSFLNGTNGTQLEIIRYLSYMVDLKQYLPDWVIVGFSTATGNDIAVHRIVSWNFT

HMMPanther: PTHR24420
164-714 FAMILY NOT NAMED,FAMILY NOT NAMED

NTQPSIQDPPSDHVAIDINSLKSNITTTWNGGIDKAKLNTAWVSYNSSSKNLSVAFTSFLNGTNGTQLEIIRYLSYMVDLKQYLPDWVIVGFSTATGNDIAVHRIVSWNFTSTALVDETTMNNTQVFPPPSPSANPKSGTSNIRLPIGLGVGGCIILAGGLALVWFMFIFRKRKAVGESDENPVVNCLIDDEFEKGTGPRKFSYRDLARATNNFHEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQAIQVLNWEVPLPILPSKMPVATYFAPPTSLSMLSNQTTTSERAQILSGYSYSTNSSQLTASPTTQFLSIDTEA

HMMPanther: PTHR24420:SF438
164-714 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NTQPSIQDPPSDHVAIDINSLKSNITTTWNGGIDKAKLNTAWVSYNSSSKNLSVAFTSFLNGTNGTQLEIIRYLSYMVDLKQYLPDWVIVGFSTATGNDIAVHRIVSWNFTSTALVDETTMNNTQVFPPPSPSANPKSGTSNIRLPIGLGVGGCIILAGGLALVWFMFIFRKRKAVGESDENPVVNCLIDDEFEKGTGPRKFSYRDLARATNNFHEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQAIQVLNWEVPLPILPSKMPVATYFAPPTSLSMLSNQTTTSERAQILSGYSYSTNSSQLTASPTTQFLSIDTEA

PatternScan: PS00308
IPR000985
247-256 LECTIN_LEGUME_ALPHA
Legume lectin, alpha chain, conserved site

LPDWVIVGFS

Seg: seg
310-327 seg

IGLGVGGCIILAGGLALV

Gene3D: G3DSA:3.30.200.20
360-439 no description

TGPRKFSYRDLARATNNFHEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIG

superfamily: SSF56112
IPR011009
363-679 Protein kinase-like (PK-like)
Protein kinase-like domain

RKFSYRDLARATNNFHEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQAIQVLNWEVPLPILPSKMPVATYFAPPTSLSMLSNQTT

ProfileScan: PS50011
IPR000719
377-655 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQAIQVLNWEVPLPIL

HMMSmart: SM00220
IPR002290
377-646 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FHEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQAIQVL

HMMSmart: SM00219
IPR020635
377-646 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FHEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQAIQVL

HMMPfam: PF00069
IPR000719
378-642 Pkinase,Ser-thr
Protein kinase, catalytic domain

HEGEKLGEGGFGGVYIAFIKNLNSYVAIKRISNGSKQGLKEYASEVRIISRLRHRNLVQLIGWCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQA

Seg: seg
379-390 seg

EGEKLGEGGFGG

PatternScan: PS00107
IPR017441
383-406 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGGVYIAFIKNLNSYVAIK

Gene3D: G3DSA:1.10.510.10
440-645 no description

WCHEKRELLLVYEFMPNSSLDSHLFKINSLLSWQIRYKIARGLASGLFYLHEEWEQCVLHRDIKSSNVMLDSNFNVKLGDFGLARLVDHGKQSPTTIVAGTRGYMALEYVTTGKASKESDVYSFGVVALEIACGRKPIDLNLESSEIEMVEWVWELYGEGKVIQAADPKLYGQFDENQMESLMTVGLWCAHPDYRFRPSIQQAIQV

PatternScan: PS00108
IPR008271
497-509 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDIKSSNVML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox