PRGDB00172589 (ppa018962m)

From PRG Wiki
Jump to: navigation, search
ppa018962m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

DNA Sequence

ATGGCGGAGAGTCAGAGGTGTAATCCCATCGCCTTCGCCATTCTCGACCCGGTTGATTTCTTGGCTCTGCAATCCATTCGCAAATCTCTCAATGACATGCCTGGCTCCAACTACTTCGCTTCCTGGGACTTCACTTCCGACCCCTGCAACTTCGCCGGCGTGTACTGCGACTCCGATAAGGTGATAGCTCTCAACCTCGGCGACCCCAGAGCCGGAGCTCCGGGACTAACGGGTCGGATCGACCCTGCCGTTGGCAAGCTCTCTGCACTCGCCGAGCTCTCGGTGGTTCCGGGTCGGATCTTCGGCGCTCTGCCGCAATCCATTTCGCAGTTGAAGAGCCTCCGGTTCCTCGCCGTCAGCCGCAACTTCATCTCCGGTCAGATTCCTGCGGGTCTCGGTCAGCTACGCAACCTGAGAACACTCGACCTCAGCTACAACCTGTTCGCCGGAGCAATTCCTACAGCTATCGGAACCTTACCAGAGCTCTCCAACGTCATTCTCTGCCACAATCGCCTCTCCGGTTCGGTCCCTCCGTTTGCCTCCCAAACCTTAACCCGGCTCGACTTGAAGCACAACGACCTCTCCGGTTCGCTCGCTCCCAACTCCCTCCCTCCTTCTCTCCAATACCTGTCTCTCTCCTGGAACCGGCTAACCGGTCCGGTCGACGGCCTCCTGAACCGGCTAGGCCAGCTCAACTATCTCGACCTCAGTATGAACCAGTTTACGGGTACGATTCCGGGTCGGGTCTTCACATACCCAATCACCAATCTCCAGCTGCAGAGAAACATGTTTTCAGGCCGGGTCCAACCGGATGGTCAGGTTTCAATATCGACCATTGATCTCAGCTACAATCGGTTATCGGGTGAAATCTCACCGTTGTTCTCTACCGTACAGAGTCTGTACCTGAATAACAACCGGTTCACGGGTCAGGTTCCGGGTAGTTTCGTGGATCGGTTACTGGCTGCGAATATACAGATACTGTATCTGCAGCACAATTTTCTTACTGGGATTCAGATTAATCCGACGGCTGAGATTCCAGTGAGCAGCTCGCTGTGTCTGCAGTATAATTGCATGGTCCCGCCCCTACAGACGCCGTGCCCATTGAAGGCTGGGAAGCAGAAGACTAGGCCGACAGCGCAGTGCAACGAGTGGAGGGGGTAA


Protein sequences

Name Description Sequence
ppa018962m Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

MAESQRCNPIAFAILDPVDFLALQSIRKSLNDMPGSNYFASWDFTSDPCNFAGVYCDSDKVIALNLGDPRAGAPGLTGRIDPAVGKLSALAELSVVPGRIFGALPQSISQLKSLRFLAVSRNFISGQIPAGLGQLRNLRTLDLSYNLFAGAIPTAIGTLPELSNVILCHNRLSGSVPPFASQTLTRLDLKHNDLSGSLAPNSLPPSLQYLSLSWNRLTGPVDGLLNRLGQLNYLDLSMNQFTGTIPGRVFTYPITNLQLQRNMFSGRVQPDGQVSISTIDLSYNRLSGEISPLFSTVQSLYLNNNRFTGQVPGSFVDRLLAANIQILYLQHNFLTGIQINPTAEIPVSSSLCLQYNCMVPPLQTPCPLKAGKQKTRPTAQCNEWRG*


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
12-379 L domain-like,LRR

FAILDPVDFLALQSIRKSLNDMPGSNYFASWDFTSDPCNFAGVYCDSDKVIALNLGDPRAGAPGLTGRIDPAVGKLSALAELSVVPGRIFGALPQSISQLKSLRFLAVSRNFISGQIPAGLGQLRNLRTLDLSYNLFAGAIPTAIGTLPELSNVILCHNRLSGSVPPFASQTLTRLDLKHNDLSGSLAPNSLPPSLQYLSLSWNRLTGPVDGLLNRLGQLNYLDLSMNQFTGTIPGRVFTYPITNLQLQRNMFSGRVQPDGQVSISTIDLSYNRLSGEISPLFSTVQSLYLNNNRFTGQVPGSFVDRLLAANIQILYLQHNFLTGIQINPTAEIPVSSSLCLQYNCMVPPLQTPCPLKAGKQKTRPTA

HMMPanther: PTHR26393:SF474
13-377 LEUCINE-RICH REPEAT FAMILY PROTEIN

AILDPVDFLALQSIRKSLNDMPGSNYFASWDFTSDPCNFAGVYCDSDKVIALNLGDPRAGAPGLTGRIDPAVGKLSALAELSVVPGRIFGALPQSISQLKSLRFLAVSRNFISGQIPAGLGQLRNLRTLDLSYNLFAGAIPTAIGTLPELSNVILCHNRLSGSVPPFASQTLTRLDLKHNDLSGSLAPNSLPPSLQYLSLSWNRLTGPVDGLLNRLGQLNYLDLSMNQFTGTIPGRVFTYPITNLQLQRNMFSGRVQPDGQVSISTIDLSYNRLSGEISPLFSTVQSLYLNNNRFTGQVPGSFVDRLLAANIQILYLQHNFLTGIQINPTAEIPVSSSLCLQYNCMVPPLQTPCPLKAGKQKTRP

HMMPanther: PTHR26393
13-377 FAMILY NOT NAMED,FAMILY NOT NAMED

AILDPVDFLALQSIRKSLNDMPGSNYFASWDFTSDPCNFAGVYCDSDKVIALNLGDPRAGAPGLTGRIDPAVGKLSALAELSVVPGRIFGALPQSISQLKSLRFLAVSRNFISGQIPAGLGQLRNLRTLDLSYNLFAGAIPTAIGTLPELSNVILCHNRLSGSVPPFASQTLTRLDLKHNDLSGSLAPNSLPPSLQYLSLSWNRLTGPVDGLLNRLGQLNYLDLSMNQFTGTIPGRVFTYPITNLQLQRNMFSGRVQPDGQVSISTIDLSYNRLSGEISPLFSTVQSLYLNNNRFTGQVPGSFVDRLLAANIQILYLQHNFLTGIQINPTAEIPVSSSLCLQYNCMVPPLQTPCPLKAGKQKTRP

HMMPfam: PF08263
IPR013210
19-57 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DFLALQSIRKSLNDMPGSNYFASWDFTSDPCNFAGVYCD

Gene3D: G3DSA:3.80.10.10
21-190 no description

LALQSIRKSLNDMPGSNYFASWDFTSDPCNFAGVYCDSDKVIALNLGDPRAGAPGLTGRIDPAVGKLSALAELSVVPGRIFGALPQSISQLKSLRFLAVSRNFISGQIPAGLGQLRNLRTLDLSYNLFAGAIPTAIGTLPELSNVILCHNRLSGSVPPFASQTLTRLDLK

HMMPfam: PF13516
135-148 LRR_6,Leucine Rich repeat

LRNLRTLDLSYNLF

Gene3D: G3DSA:3.80.10.10
191-358 no description

HNDLSGSLAPNSLPPSLQYLSLSWNRLTGPVDGLLNRLGQLNYLDLSMNQFTGTIPGRVFTYPITNLQLQRNMFSGRVQPDGQVSISTIDLSYNRLSGEISPLFSTVQSLYLNNNRFTGQVPGSFVDRLLAANIQILYLQHNFLTGIQINPTAEIPVSSSLCLQYNCM

Seg: seg
200-213 seg

PNSLPPSLQYLSLS

HMMPfam: PF13504
205-218 LRR_7,Leucine rich repeat

PSLQYLSLSWNRLT

HMMPfam: PF00560
IPR001611
230-250 LRR_1
Leucine-rich repeat

QLNYLDLSMNQFTGTIPGRVF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox