PRGDB00172591 (ppa000808m)

From PRG Wiki
Jump to: navigation, search
ppa000808m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

receptor-like kinase in flowers 1 (best arabidopsis hit)

DNA Sequence

ATGATGCTGGTTGGTAATGTCTTTGTTTGCTTCATTACTGCATTTAGTTGCTTCACACTGCTGGAACTTGCTGAATCTAAGTTGCCCCAAGAGGAAGTTGATGCCCTCCAACAAATTACCACCACAATGGGCGCAAAATATTGGAGGTTTAACAATGATGCTTGCCGAATTGAAATGGTGGGTGTAACGGAGAAGCCACCAAAGGGAGCCCAGAGCAACACTGATTGTGAATGCTACTTTGAGAACAACACTGTTTGTCATGTCGTAAAACTAATGCTCAAGGGTTATAGTTTACCTGGTTTGCTTCCACCTCAACTGGTCAAGCTTCCTTACCTCAGAGAAATTGATTTTGCTTACAACTATCTCAATGGTACAATACCACCGGAATGGGCTTCAACGAAACTAACTTATATTTCTGTTCTGGTCAATCGCTTATCAGGACAAATTCCAAAGGAGCTAGGAAACATTACCACTCTGACATACCTGAGCCTTGAATCAAACAAATTTTCTGGTATTCTTCCTATTGAGCTTGGGAACTTGATCAATTTGCAGACCTTGATGCTTTCCTCCAATCAGCTGACTGGAAAATTACCAGAGGCGTTTTCTGGGATAAGAACTTTGACAGATTTCCGAATAAATGATAACAACTTCAATGGAACACTCCCTGATTGGGTGCAGAACTGGAAACAACTCAGAAGATTGGAAATGCATTCAAGTGGACTGGAGGGACCCATTCCATCAAATATTTCTCAATTGTACAATTTAAATGAGTTGAGGATTAGTGATTTAAATGGGCCAATTCAGGAATTTCCTTTGCTGAGAAATATGACAGGCATAGTAAGATTGGTTTTGAGGAACTGCAACATTTTTGGGGAGATCCCTGCATATATCTGGTCCATGAAGAATCTGACGATGTTGGATGTCAGTTTTAACAAGTTAGTGGGTGAACTTTCATCCACAATAGGAGCTGAGCGTCTGAAATTTGTCTTTTTGACTGGCAACCTGCTAAGTGGAAATGTGCCACAGTCAATCTTGCGAGATGGAAATAGTGTTGATTTGTCATACAATAACTTCACGTTGAAAGGCCCACTGGATTGTCAAGATAACTTGAATCTAAATCTGAACTTGTACCGGAGCTCTTCGAAGGAGAACAACTCAATGGGAATTCTTCCATGCTTGAAGAATTTTAAGTGCTCACGATATTCAAAATGTATGCATGTTAATTGTGGTGGAGGTGACATAACGTTCAAGGACGAGAATAACACGAAGGTTTTGTATGAAGGAGATGGAGCAGTTGAAGGTGGTACTGCAAAATATTATAGAAATGACAGAAGTATGTGGGGATTTAGCAGCACTGGTGACTTCATGGATGACTACGATTTACAGAATACACGTTACTCTATATCTCTGGCATCTTCGAATCTCTCTGAATTATATACGACAGCACGCATATCTCCAATTTCACTTACTTATTTCTTCTATTGTTTAGAAAATGGGAGTTACACTATAACTCTCCATTTTGCGGAGATTAAGTTCACAAATGACAAAGGATACAGTAGTCTGGGGAGGCGTATTTTTGATATCTATGTTCAGGAAATATTGGTGTGGAAGGATTTCAATATTGAAGATGAGGCAGGTATGGCTCAAAAGAAGTTGGTTAAACAAGTACCTAATGTCAATGTGACAAGTAATGTCTTAGAGATCCGATTCTATTGGGCCGGAAAAGGGACAACGAGGACTCCTGAGAGAGGAGATTATGGTCCCCTTATATCAGCTATTTCTGTGGTTTCCTATCTTAAACCGTGTACAAATGGTGGAAATGCACGAACTATTTATATTGTTGCTGGTGTTGCCGTTGGGGCACTATGCCTAACACTCTTCATACTGGCTATCCTTTGGTGGAAAGGATTATTGCGAGGGAAAAGGGGGAGACAAAAAGGACGAGATATGCAGACAGGGACGTTTACTTTGAAACAAATAAAAGTGGCCACTGATGACTTTGATCCTTCAAACAAGATTGGAGAAGGTGGTTTTGGTCCTGTCTACAAGGGTCACTTACCTGATGGTTCTTTGGTAGCAGTTAAGCAGCTTTCATCCAACTCAAGGCAAGGAAACCGTGAATTTTTAAATGAGATGGGCATGATATCTTGTGTGCAACACCCAAATCTAGTGAAACTGCATGGATGCTGTATTGAAGGGGACCAACTATTGCTGGTGTACGAGTACATGGAAAACAATAGTCTTGCAGGCGCCTTATTTGGCCGGGAAAACCATCGGATTAAACTGGACTGGCCTACGAGGCTTAACATCTGTACTGGGATAGCAAGAGGTCTAGCTTTTCTACATGAAGAATCAAGACTCAAGATTGTTCACAGAGACATAAAAGCTACCAACGTGCTCCTGGATGGGGATTTGAACCCTAAAATATCTGACTTTGGATTGGCTAAGCTTGATGAAGAGGAGAAAACACACATTAGCACCAGGGTTGCTGGAACCATAGGATATATGGCGCCAGAATATGCACTATGGGGTCGCTTGACCTATAAGGCAGATGTTTACAGCTTCGGAGTTGTTGTCTTGGAAGTCGTTAGCGGGAAGAAGAACAGTTATGCCCCAAGTGACAGTTGTGTCTGTCTCCTAGACTGGGCCTGTCATTTGCAACAAACTGGAAACTTGAAGGAGCTGGTTGATGAAAGGTTAAGGTATGAAGTGAATGGTCAAGAAGCAGAAGTAATGGTTAAAGTTGGTCTGTTGTGCACAAATGCGTCTCCATCACTTAGGCCTACAATGTCCGAGGTGGTGAGCATGCTTGAAGGACGAACACCAGTCCCAGACGTTGCGGTCCCAGAAGCAAGTACGCATTTGATGTTCAAGGCTATGAGGGATGTCCATGACCGAAGTCAAAAACAGAGTTTAGGCGGAAGCCAATCCCAGAATGTGACAACTAATATTACATTTTGCTCTTCCTCTACCCCAGGCCATGATTTGAATTAA


Protein sequences

Name Description Sequence
ppa000808m receptor-like kinase in flowers 1 (best arabidopsis hit)

MMLVGNVFVCFITAFSCFTLLELAESKLPQEEVDALQQITTTMGAKYWRFNNDACRIEMVGVTEKPPKGAQSNTDCECYFENNTVCHVVKLMLKGYSLPGLLPPQLVKLPYLREIDFAYNYLNGTIPPEWASTKLTYISVLVNRLSGQIPKELGNITTLTYLSLESNKFSGILPIELGNLINLQTLMLSSNQLTGKLPEAFSGIRTLTDFRINDNNFNGTLPDWVQNWKQLRRLEMHSSGLEGPIPSNISQLYNLNELRISDLNGPIQEFPLLRNMTGIVRLVLRNCNIFGEIPAYIWSMKNLTMLDVSFNKLVGELSSTIGAERLKFVFLTGNLLSGNVPQSILRDGNSVDLSYNNFTLKGPLDCQDNLNLNLNLYRSSSKENNSMGILPCLKNFKCSRYSKCMHVNCGGGDITFKDENNTKVLYEGDGAVEGGTAKYYRNDRSMWGFSSTGDFMDDYDLQNTRYSISLASSNLSELYTTARISPISLTYFFYCLENGSYTITLHFAEIKFTNDKGYSSLGRRIFDIYVQEILVWKDFNIEDEAGMAQKKLVKQVPNVNVTSNVLEIRFYWAGKGTTRTPERGDYGPLISAISVVSYLKPCTNGGNARTIYIVAGVAVGALCLTLFILAILWWKGLLRGKRGRQKGRDMQTGTFTLKQIKVATDDFDPSNKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGCCIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSMLEGRTPVPDVAVPEASTHLMFKAMRDVHDRSQKQSLGGSQSQNVTTNITFCSSSTPGHDLN*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF698
14-945 RKF1 (RECEPTOR-LIKE KINASE IN FLOWERS 1); ATP BINDING / PROTEIN SERINE/THREONIN

AFSCFTLLELAESKLPQEEVDALQQITTTMGAKYWRFNNDACRIEMVGVTEKPPKGAQSNTDCECYFENNTVCHVVKLMLKGYSLPGLLPPQLVKLPYLREIDFAYNYLNGTIPPEWASTKLTYISVLVNRLSGQIPKELGNITTLTYLSLESNKFSGILPIELGNLINLQTLMLSSNQLTGKLPEAFSGIRTLTDFRINDNNFNGTLPDWVQNWKQLRRLEMHSSGLEGPIPSNISQLYNLNELRISDLNGPIQEFPLLRNMTGIVRLVLRNCNIFGEIPAYIWSMKNLTMLDVSFNKLVGELSSTIGAERLKFVFLTGNLLSGNVPQSILRDGNSVDLSYNNFTLKGPLDCQDNLNLNLNLYRSSSKENNSMGILPCLKNFKCSRYSKCMHVNCGGGDITFKDENNTKVLYEGDGAVEGGTAKYYRNDRSMWGFSSTGDFMDDYDLQNTRYSISLASSNLSELYTTARISPISLTYFFYCLENGSYTITLHFAEIKFTNDKGYSSLGRRIFDIYVQEILVWKDFNIEDEAGMAQKKLVKQVPNVNVTSNVLEIRFYWAGKGTTRTPERGDYGPLISAISVVSYLKPCTNGGNARTIYIVAGVAVGALCLTLFILAILWWKGLLRGKRGRQKGRDMQTGTFTLKQIKVATDDFDPSNKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGCCIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSMLEGRTPVPD

HMMPanther: PTHR24420
14-945 FAMILY NOT NAMED,FAMILY NOT NAMED

AFSCFTLLELAESKLPQEEVDALQQITTTMGAKYWRFNNDACRIEMVGVTEKPPKGAQSNTDCECYFENNTVCHVVKLMLKGYSLPGLLPPQLVKLPYLREIDFAYNYLNGTIPPEWASTKLTYISVLVNRLSGQIPKELGNITTLTYLSLESNKFSGILPIELGNLINLQTLMLSSNQLTGKLPEAFSGIRTLTDFRINDNNFNGTLPDWVQNWKQLRRLEMHSSGLEGPIPSNISQLYNLNELRISDLNGPIQEFPLLRNMTGIVRLVLRNCNIFGEIPAYIWSMKNLTMLDVSFNKLVGELSSTIGAERLKFVFLTGNLLSGNVPQSILRDGNSVDLSYNNFTLKGPLDCQDNLNLNLNLYRSSSKENNSMGILPCLKNFKCSRYSKCMHVNCGGGDITFKDENNTKVLYEGDGAVEGGTAKYYRNDRSMWGFSSTGDFMDDYDLQNTRYSISLASSNLSELYTTARISPISLTYFFYCLENGSYTITLHFAEIKFTNDKGYSSLGRRIFDIYVQEILVWKDFNIEDEAGMAQKKLVKQVPNVNVTSNVLEIRFYWAGKGTTRTPERGDYGPLISAISVVSYLKPCTNGGNARTIYIVAGVAVGALCLTLFILAILWWKGLLRGKRGRQKGRDMQTGTFTLKQIKVATDDFDPSNKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGCCIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSMLEGRTPVPD

superfamily: SSF52058
76-346 L domain-like,LRR

CECYFENNTVCHVVKLMLKGYSLPGLLPPQLVKLPYLREIDFAYNYLNGTIPPEWASTKLTYISVLVNRLSGQIPKELGNITTLTYLSLESNKFSGILPIELGNLINLQTLMLSSNQLTGKLPEAFSGIRTLTDFRINDNNFNGTLPDWVQNWKQLRRLEMHSSGLEGPIPSNISQLYNLNELRISDLNGPIQEFPLLRNMTGIVRLVLRNCNIFGEIPAYIWSMKNLTMLDVSFNKLVGELSSTIGAERLKFVFLTGNLLSGNVPQSILR

Gene3D: G3DSA:3.80.10.10
86-264 no description

CHVVKLMLKGYSLPGLLPPQLVKLPYLREIDFAYNYLNGTIPPEWASTKLTYISVLVNRLSGQIPKELGNITTLTYLSLESNKFSGILPIELGNLINLQTLMLSSNQLTGKLPEAFSGIRTLTDFRINDNNFNGTLPDWVQNWKQLRRLEMHSSGLEGPIPSNISQLYNLNELRISDLN

HMMPfam: PF13855
158-216 LRR_8,Leucine rich repeat

TLTYLSLESNKFSGILPIELGNLINLQTLMLSSNQLTGKLPEAFSGIRTLTDFRINDNN

Gene3D: G3DSA:3.80.10.10
273-396 no description

LRNMTGIVRLVLRNCNIFGEIPAYIWSMKNLTMLDVSFNKLVGELSSTIGAERLKFVFLTGNLLSGNVPQSILRDGNSVDLSYNNFTLKGPLDCQDNLNLNLNLYRSSSKENNSMGILPCLKNF

Seg: seg
369-376 seg

NLNLNLNL

HMMPfam: PF11721
IPR021720
404-593 Malectin
Malectin

CMHVNCGGGDITFKDENNTKVLYEGDGAVEGGTAKYYRNDRSMWGFSSTGDFMDDYDLQNTRYSISLASSNLSELYTTARISPISLTYFFYCLENGSYTITLHFAEIKFTNDKGYSSLGRRIFDIYVQEILVWKDFNIEDEAGMAQKKLVKQVPNVNVTSNVLEIRFYWAGKGTTRTPERGDYGPLISAI

Seg: seg
632-648 seg

LWWKGLLRGKRGRQKGR

superfamily: SSF56112
IPR011009
639-960 Protein kinase-like (PK-like)
Protein kinase-like domain

RGKRGRQKGRDMQTGTFTLKQIKVATDDFDPSNKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGCCIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSMLEGRTPVPDVAVPEASTHLMFKAM

Gene3D: G3DSA:3.30.200.20
652-729 no description

TGTFTLKQIKVATDDFDPSNKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGC

ProfileScan: PS50011
IPR000719
667-957 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDPSNKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGCCIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSMLEGRTPVPDVAVPEASTHLMF

HMMSmart: SM00219
IPR020635
667-937 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDPSNKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGCCIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSML

HMMSmart: SM00220
IPR002290
667-937 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDPSNKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGCCIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSML

HMMPfam: PF07714
IPR001245
671-937 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NKIGEGGFGPVYKGHLPDGSLVAVKQLSSNSRQGNREFLNEMGMISCVQHPNLVKLHGCCIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSML

Gene3D: G3DSA:1.10.510.10
730-938 no description

CIEGDQLLLVYEYMENNSLAGALFGRENHRIKLDWPTRLNICTGIARGLAFLHEESRLKIVHRDIKATNVLLDGDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGRLTYKADVYSFGVVVLEVVSGKKNSYAPSDSCVCLLDWACHLQQTGNLKELVDERLRYEVNGQEAEVMVKVGLLCTNASPSLRPTMSEVVSMLE

PatternScan: PS00108
IPR008271
789-801 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKATNVLL

Seg: seg
967-978 seg

SQKQSLGGSQSQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox