PRGDB00172593 (ppa023688m)

From PRG Wiki
Jump to: navigation, search
ppa023688m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGGCTCGATTTAGGCACCAAGAAGCCTCCTCTTCCACTTCTTCTCCTTCTCCATGCTGTTATGACGTGTTCTTGAGTTTCAGAGGCGAAGACACTCGAAAGAATTTTAGCGACCATCTCTATACCGCTTGTGTGGAGAAAGGCTTTAACACGTTCCGGGATGATGAAGAACTTGAGAGAGGAGTAGATATTAAGCCAGAATTGAAGAAAGCCATCCAACAGTCACGTAGTTCTGTCATTGTATTTTCAAAAGACTACTCGTCGTCCAGATGGTGCCTTGACGAGCTTGTCTTCATCCTTGAGCAGAAGAGGATCTCGGAACACGTAGTTTTACCTGTCTTCTATGACGTTGATCCTTCCCACGTGAGGAACCAGACAGGATGTGTTGCAGAAGCATTTTCTAGGCACGAAGAAAATCAGCTATCAACGAACAAGGTCAAACAATGGCGTGCAGCACTGAGAGAAGTTGCAGATCTATCAGGGATGGTCTTACAAAACCACGCTGATGGGTACGAGTCAAAGTTTATCATGCAAATTGTTAAAGTGATTGACAACAAACTCAGTCGCACGCCCTTCGCTATTGCACCCTACCCGATTGGAATTGATTCTCGAGTTGAAAATATTAATTCATGGTTACAGGATGGATCAACCGATGTTGGAATACTTTTAGTTAATGGAGTTGGGGGAATTGGAAAGACAACCCTTGCAAAATTTGCTTACAACATAAACTTCAGAAGATTTGAACGAAGTTGTTTTCTTGAAGATGTCAGGGAAATTTCAAACCAACCCAATGGTTTAGTTCACCTACAGATACAATTCCTTCACCACATTATGAGTGGAAGAGAAGTGAAAATACAGTGTGTCAGTGAGGGAATAAAAAAGATTAGAGATGCCATAATCTCTAAAACAATTCTTCTTGTTCTTGATGATGTTGATCATATGGACCAGATAGATGCAATATTTTTTATGCAAGATTGGTTTTGCCCTGGAAGTAAAATCATGATAACAACTAGGTGTGCAGGATTATTAAGGGGTCATCAAGTAGCTAAAAGCAAAGTTTATGATGCTGAAACTTTGGATGTGGATGAATCATTACAACTCTTCAGCTGGCATGCGTTTGGCCAGGACCACCCAATTGAGGGTTACATTAGTCTGTCGAAAAGGGTAAAGGATCGATGCGGAGGACTCCCGTTAGCTCTTCAAGTTTTGGGTTCGTCTCTATCAGGACGACATATAGATGTTTGGGAAAGTACATTGGAGAAATTAAAAACTATTCCAGACAATCAAATCATCAAAAAACTCAGAATAAGCTACGACGCTTTACAAGATAACCCTGATGACCAAAATTTATTCCTCCATATTGCATGTTTTTTTGTTGGACAAGGGAAAGATTATGTTGTTAGAATACTGGATGGATGTAATTTCTTCACAATTGTTGGCATTGAAAATCTTGTGAATAGATGTTTGGTAACAATTGATGATGAAAACAACGTGAAGATGCATCAAATGATTTGGGACATGGGAAGAGAAATTGTTCGGCTAGAATCAAAGGCACCTGGAAAACGTAGTAGATTATGGCGTGATAAGGATTCTTTCGATGTATTGAAGGAAAAGAGTGGTACAGAAACAATTGAAGGTCTTGCCTTGAACATGCGTATGCTCTCAGTAAACACTCCTTCTGGCAATACGAATGAGGTAGTCTTGGAAACTAACGCATTTTCAAGGATGTCCAAACTAGAACTACTTCAGCTTTGTCATTTACGACTCAATGGATGTTATGAGGAATTTCCAAAAGGATTAAGATGGTTGTGTTGGCTTGAATTTCCATCGAAATCATTACCTAGTGAAATTCCTTTGGAGTGCTTGGTTTATCTTGAAATGCATCATAGTAACTTGAGACAAGTCTTTAACCGGAAAAAAAACTTGATACAAGTTTTAAAGAAGGGAAGAAAGCACCTTCCCTCACTGAAGACCCTTGATCTAAGTCATTCTCATAGCCTTACTGAAATCGGTAACTTCTCACTGGCCCCCAACTTAGAAAGACTGATTCTTAAAGATTGTGCGAGCTTGGTTGATGTTCATGAATCCATTGGAAACCTAAAGAGACTCAATTACTTGAATATGAAAGATTGCAAAAAGATTAGGAAACTTCCAAAGAATTTATTTATGCTAAAATCAGTTGATACACTTATTGTATCTGGATGCTCAAGTCTAAATGAGTTTCCGAAGGAGCTGAGGAACATGGAATCTCTTAAAGTGCTAAAGGTAACTCAAGTTCTGACCACCACTGGAAACGTCAAATCATGCCTGAGGAGAAATCCAGAAACTTTTTGGGCTTCTTTACCAAGTAGTTTAACACAATTAAAGCTCAAGAGTTGCAATCTTTCTGATGAGGCTTTTCCCAAAGATATTGGTAACCTACCCTCATTAGAACTATTAGATCTAAGCGACAATCCAATCTCTGGCCTACCAGATTGCATCCGAGGTGTTACACGACTTGATCAACTTCTTTTTTCAAATTGCAAGAGGCTCAAAACGCTTGTAGGGCTACCAAGGGCAAGATATTTTGGTGTGTTTGATTGTGCATTGTTGGAAAAAGTAACATTTCAATCAAGTTTGTTCGGATTCACACCGTTTGAAGTGCTTAGCATTAGTAACCCGAAGTTAATTGAGATTGAATACATGTACAAGTTAGAACCCCTTGGAAATTGTGATGGACTTTATGAATCTGGTATATTCAGCACATTTCTTCCTGGGAATGTGGTGCCAGGCCACTTCAGCTATACAAGTAAAAAGTCTTGGTCAATATCTTTTAGTGTGCCTTCTTCTACTTCTACTTTCAGGATTCGAGGTTTGAATGTCTTCTCTATGTATACATGTTCTGGTAGTGGTTCTTATGCTGGTTACAGTTGTGAGATAATTAGTCCAATAATAATCAAAGTTAGCAACAAAAGCACGGGAATGAAGTGGATCTATGACCCATCATGCTTCGGTATTCCAGATCCTGGAGAAGACATGATATTCTTAAGCCATTGGAAGATGGGGAATCAATTATTGAAAGGTGGCGACCAAGTCACAGTTTCCATGTTCATGAGATCTGTCTTTCAGCTGAAGGAGTGGGGCGTCCAGCTTGTGCACGAGCAAGATCAAGAGAATATCAGGATGATGAGGACCCAACATGACAATGATGATTATGAGTGTCCAGTTTCTTTTCCA


Protein sequences

Name Description Sequence
ppa023688m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

MARFRHQEASSSTSSPSPCCYDVFLSFRGEDTRKNFSDHLYTACVEKGFNTFRDDEELERGVDIKPELKKAIQQSRSSVIVFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRHEENQLSTNKVKQWRAALREVADLSGMVLQNHADGYESKFIMQIVKVIDNKLSRTPFAIAPYPIGIDSRVENINSWLQDGSTDVGILLVNGVGGIGKTTLAKFAYNINFRRFERSCFLEDVREISNQPNGLVHLQIQFLHHIMSGREVKIQCVSEGIKKIRDAIISKTILLVLDDVDHMDQIDAIFFMQDWFCPGSKIMITTRCAGLLRGHQVAKSKVYDAETLDVDESLQLFSWHAFGQDHPIEGYISLSKRVKDRCGGLPLALQVLGSSLSGRHIDVWESTLEKLKTIPDNQIIKKLRISYDALQDNPDDQNLFLHIACFFVGQGKDYVVRILDGCNFFTIVGIENLVNRCLVTIDDENNVKMHQMIWDMGREIVRLESKAPGKRSRLWRDKDSFDVLKEKSGTETIEGLALNMRMLSVNTPSGNTNEVVLETNAFSRMSKLELLQLCHLRLNGCYEEFPKGLRWLCWLEFPSKSLPSEIPLECLVYLEMHHSNLRQVFNRKKNLIQVLKKGRKHLPSLKTLDLSHSHSLTEIGNFSLAPNLERLILKDCASLVDVHESIGNLKRLNYLNMKDCKKIRKLPKNLFMLKSVDTLIVSGCSSLNEFPKELRNMESLKVLKVTQVLTTTGNVKSCLRRNPETFWASLPSSLTQLKLKSCNLSDEAFPKDIGNLPSLELLDLSDNPISGLPDCIRGVTRLDQLLFSNCKRLKTLVGLPRARYFGVFDCALLEKVTFQSSLFGFTPFEVLSISNPKLIEIEYMYKLEPLGNCDGLYESGIFSTFLPGNVVPGHFSYTSKKSWSISFSVPSSTSTFRIRGLNVFSMYTCSGSGSYAGYSCEIISPIIIKVSNKSTGMKWIYDPSCFGIPDPGEDMIFLSHWKMGNQLLKGGDQVTVSMFMRSVFQLKEWGVQLVHEQDQENIRMMRTQHDNDDYECPVSFP

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
9-162 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

ASSSTSSPSPCCYDVFLSFRGEDTRKNFSDHLYTACVEKGFNTFRDDEELERGVDIKPELKKAIQQSRSSVIVFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRHEENQLSTNKVKQWRAALREVADLSGM

Seg: seg
10-18 seg

SSSTSSPSP

Gene3D: G3DSA:3.40.50.10140
18-150 no description

PCCYDVFLSFRGEDTRKNFSDHLYTACVEKGFNTFRDDEELERGVDIKPELKKAIQQSRSSVIVFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRHEENQLSTNKVKQWR

HMMSmart: SM00255
IPR000157
20-159 Toll
Toll/interleukin-1 receptor homology (TIR) domain

CYDVFLSFRGEDTRKNFSDHLYTACVEKGFNTFRDDEELERGVDIKPELKKAIQQSRSSVIVFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRHEENQLSTNKVKQWRAALREVADL

ProfileScan: PS50104
IPR000157
21-159 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YDVFLSFRGEDTRKNFSDHLYTACVEKGFNTFRDDEELERGVDIKPELKKAIQQSRSSVIVFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRHEENQLSTNKVKQWRAALREVADL

HMMPfam: PF01582
IPR000157
23-154 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKNFSDHLYTACVEKGFNTFRDDEELERGVDIKPELKKAIQQSRSSVIVFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRHEENQLSTNKVKQWRAALR

HMMPanther: PTHR11017:SF20
49-852 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FNTFRDDEELERGVDIKPELKKAIQQSRSSVIVFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRHEENQLSTNKVKQWRAALREVADLSGMVLQNHADGYESKFIMQIVKVIDNKLSRTPFAIAPYPIGIDSRVENINSWLQDGSTDVGILLVNGVGGIGKTTLAKFAYNINFRRFERSCFLEDVREISNQPNGLVHLQIQFLHHIMSGREVKIQCVSEGIKKIRDAIISKTILLVLDDVDHMDQIDAIFFMQDWFCPGSKIMITTRCAGLLRGHQVAKSKVYDAETLDVDESLQLFSWHAFGQDHPIEGYISLSKRVKDRCGGLPLALQVLGSSLSGRHIDVWESTLEKLKTIPDNQIIKKLRISYDALQDNPDDQNLFLHIACFFVGQGKDYVVRILDGCNFFTIVGIENLVNRCLVTIDDENNVKMHQMIWDMGREIVRLESKAPGKRSRLWRDKDSFDVLKEKSGTETIEGLALNMRMLSVNTPSGNTNEVVLETNAFSRMSKLELLQLCHLRLNGCYEEFPKGLRWLCWLEFPSKSLPSEIPLECLVYLEMHHSNLRQVFNRKKNLIQVLKKGRKHLPSLKTLDLSHSHSLTEIGNFSLAPNLERLILKDCASLVDVHESIGNLKRLNYLNMKDCKKIRKLPKNLFMLKSVDTLIVSGCSSLNEFPKELRNMESLKVLKVTQVLTTTGNVKSCLRRNPETFWASLPSSLTQLKLKSCNLSDEAFPKDIGNLPSLELLDLSDNPISGLPDCIRGVTRLDQLLFSNCKRLKTLVGLPR

HMMPanther: PTHR11017
49-852 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FNTFRDDEELERGVDIKPELKKAIQQSRSSVIVFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRHEENQLSTNKVKQWRAALREVADLSGMVLQNHADGYESKFIMQIVKVIDNKLSRTPFAIAPYPIGIDSRVENINSWLQDGSTDVGILLVNGVGGIGKTTLAKFAYNINFRRFERSCFLEDVREISNQPNGLVHLQIQFLHHIMSGREVKIQCVSEGIKKIRDAIISKTILLVLDDVDHMDQIDAIFFMQDWFCPGSKIMITTRCAGLLRGHQVAKSKVYDAETLDVDESLQLFSWHAFGQDHPIEGYISLSKRVKDRCGGLPLALQVLGSSLSGRHIDVWESTLEKLKTIPDNQIIKKLRISYDALQDNPDDQNLFLHIACFFVGQGKDYVVRILDGCNFFTIVGIENLVNRCLVTIDDENNVKMHQMIWDMGREIVRLESKAPGKRSRLWRDKDSFDVLKEKSGTETIEGLALNMRMLSVNTPSGNTNEVVLETNAFSRMSKLELLQLCHLRLNGCYEEFPKGLRWLCWLEFPSKSLPSEIPLECLVYLEMHHSNLRQVFNRKKNLIQVLKKGRKHLPSLKTLDLSHSHSLTEIGNFSLAPNLERLILKDCASLVDVHESIGNLKRLNYLNMKDCKKIRKLPKNLFMLKSVDTLIVSGCSSLNEFPKELRNMESLKVLKVTQVLTTTGNVKSCLRRNPETFWASLPSSLTQLKLKSCNLSDEAFPKDIGNLPSLELLDLSDNPISGLPDCIRGVTRLDQLLFSNCKRLKTLVGLPR

superfamily: SSF52540
181-430 P-loop containing nucleoside triphosphate hydrolases

KVIDNKLSRTPFAIAPYPIGIDSRVENINSWLQDGSTDVGILLVNGVGGIGKTTLAKFAYNINFRRFERSCFLEDVREISNQPNGLVHLQIQFLHHIMSGREVKIQCVSEGIKKIRDAIISKTILLVLDDVDHMDQIDAIFFMQDWFCPGSKIMITTRCAGLLRGHQVAKSKVYDAETLDVDESLQLFSWHAFGQDHPIEGYISLSKRVKDRCGGLPLALQVLGSSLSGRHIDVWESTLEKLKTIPDNQI

HMMPfam: PF00931
IPR002182
202-477 NB-ARC,NBS
NB-ARC

DSRVENINSWLQDGSTDVGILLVNGVGGIGKTTLAKFAYNINFRRFERSCFLEDVREISNQPNGLVHLQIQFLHHIMSGREVKIQCVSEGIKKIRDAIISKTILLVLDDVDHMDQIDAIFFMQDWFCPGSKIMITTRCAGLLRGHQVAKSKVYDAETLDVDESLQLFSWHAFGQDHPIEGYISLSKRVKDRCGGLPLALQVLGSSLSGRHIDVWESTLEKLKTIPDNQIIKKLRISYDALQDNPDDQNLFLHIACFFVGQGKDYVVRILDGCNFFT

Seg: seg
219-231 seg

VGILLVNGVGGIG

FPrintScan: PR00364
IPR000767
221-236 DISEASERSIST
Disease resistance protein

ILLVNGVGGIGKTTLA

FPrintScan: PR00364
IPR000767
298-312 DISEASERSIST
Disease resistance protein

AIISKTILLVLDDVD

FPrintScan: PR00364
IPR000767
393-407 DISEASERSIST
Disease resistance protein

CGGLPLALQVLGSSL

superfamily: SSF52058
499-893 L domain-like,LRR

KMHQMIWDMGREIVRLESKAPGKRSRLWRDKDSFDVLKEKSGTETIEGLALNMRMLSVNTPSGNTNEVVLETNAFSRMSKLELLQLCHLRLNGCYEEFPKGLRWLCWLEFPSKSLPSEIPLECLVYLEMHHSNLRQVFNRKKNLIQVLKKGRKHLPSLKTLDLSHSHSLTEIGNFSLAPNLERLILKDCASLVDVHESIGNLKRLNYLNMKDCKKIRKLPKNLFMLKSVDTLIVSGCSSLNEFPKELRNMESLKVLKVTQVLTTTGNVKSCLRRNPETFWASLPSSLTQLKLKSCNLSDEAFPKDIGNLPSLELLDLSDNPISGLPDCIRGVTRLDQLLFSNCKRLKTLVGLPRARYFGVFDCALLEKVTFQSSLFGFTPFEVLSISNPKLIEIE

Gene3D: G3DSA:3.80.10.10
611-853 no description

KSLPSEIPLECLVYLEMHHSNLRQVFNRKKNLIQVLKKGRKHLPSLKTLDLSHSHSLTEIGNFSLAPNLERLILKDCASLVDVHESIGNLKRLNYLNMKDCKKIRKLPKNLFMLKSVDTLIVSGCSSLNEFPKELRNMESLKVLKVTQVLTTTGNVKSCLRRNPETFWASLPSSLTQLKLKSCNLSDEAFPKDIGNLPSLELLDLSDNPISGLPDCIRGVTRLDQLLFSNCKRLKTLVGLPRA

FPrintScan: PR00364
IPR000767
651-667 DISEASERSIST
Disease resistance protein

KHLPSLKTLDLSHSHSL

ProfileScan: PS51450
IPR001611
655-677 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKTLDLSHSHSLTEIGNFSLAP

Seg: seg
751-763 seg

LKVLKVTQVLTTT

HMMPfam: PF12799
784-824 LRR_4,Leucine Rich repeats (2 copies)

SLTQLKLKSCNLSDEAFPKDIGNLPSLELLDLSDNPISGLP

ProfileScan: PS51450
IPR001611
809-830 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLELLDLSDNPISGLPDCIRGV

Seg: seg
926-947 seg

FSYTSKKSWSISFSVPSSTSTF

Seg: seg
961-970 seg

SGSGSYAGYS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox