PRGDB00172596 (ppa021490m)

From PRG Wiki
Jump to: navigation, search
ppa021490m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

DNA Sequence

ATGGCATCGAGCAGCCAAAGGGCCTTCACTTCAGCTACTGCAGTTTGTCCATGGAAATACGAAGTGTTTTTGAGTTTCAGGGGTGAAGACACTCGCAGGGGTTTTACAGACTATTTATTCAAACAGTTGGACTGGCGAGGAATTAGAACTTTCAGGGATGATCCAGATCTTGAAAGAGGGACAGATATCAATCCGGAGCTTCTGACCGCGATTGAACAATCAAGGTTTGCAATCATAGTTCTTTCAACAAACTATGCTTCATCAAGTTGGTGTTTGCGTGAACTAACCCATATTGTTCAGTCCGAGATGGAGAGAATTTTCCCAATTTTTTATTATGTGGATCCCTCTGATGTACGACATCAACGGGGGAGTTTTGGGGCAGCCCTCGTTAACCATGAAAGGAATTGTGGGGAAGACAGAGAGGAGGTGCTGGAGTGGAGAAATGCTTTAAAAAAAGTTGCTAATCTCGCTGGGCGGAATTCAAAGGATTACAGGTATGATACAGAGCTTATCACAGAAATTGTTGATGCAGTGTGGGATAAAGTGCATCCCACATTTTCATTGTATGATTCCTCAGAGATATTAGTCGGATTTGATACTAAACTAAAGGAAATAGATCTGCATTTAGATACAAGCGCAAATGATGTGCGCTTTGTGGGGATATGGGGGATGGGCGGAATGGGTAAGACAACCCTAGCTAGATTAGTTTATGAGAGAATTTCTCATAGTTTTGAAGGTAGCAGCTTTCTTGCAAATGTCAGAGAGGTTTATGCAACACATGGTCTAGTTCCTTTACAGAAACAGCTTCTTTCCAATATCTTGAAGAAAGTAAATATACAAGTTTGTGATGCTTATAGTGGATTTACTATGATAAAGAGGTGTCTATGTAATAAAAAGGTTCTTCTCATTCTTGATGATGTAGATCAATCAGAGCAACTGGAAATGTTGATCAGAGAAAAAGACTGCTTTGGTTTGGGAAGTAGAATCATCATTACAACTAGAGATGAACGTTTGTTAGTCGAACAAGGGATAGAGAAGATATATAAGGTCTTGCCATTAACCCAACATGAAGCTCGTCATCTCTTTAGTAAGAAGGCCTTTCAAAAAGATGACCTTGAAGAAGATTATCTAGAACTGTCTAAAAGTTTCATAAAGTATGCAGGAGGTCTTCCATTAGCTCTTAAAACTTTGGGGTCTTTTTTGTACAAAAGAAGTCAAGATGAATGGAAGAGTGCACTAGATAAACTGAAGCAAGCTCCTGACAGGAAAATTTTGAAAATTTTGAAAATAAGCTATGATGGACTAGAGGAAATGCAGAAGAAAATTTTTCTTGATGTTGCATGTTTCCATAAGTGTGATGACAAGGAAGAAGTGATTGAAATTCTAGACAGTTGTGGTTTTGTTGGCGCTCGTATTGGGATACATGTTCTTATTGAGAAATCTCTCTTGTCTCTTTCAGACAAGTGTGTGTCTATGCATGATTTGATACAAGAAATGGCATGGGAGATTGTTCGTCAAGAGTCTTTTGACGAGCCAGGTGGTCGCAGTCGCTTGTGGCTTTACAGGGACATCCTTCATGTACTCACGAACAATATGGGAACAGAAGCCATTGAAGGCATAGTCCTACGCTTACATGAATTTGAAGCGGCACACTGGAATCCTGAAGCATTCACTAAGATGTGTAAACTAAAGTTGCTCAAGATTAATAATTTTCGCCTTTCTTTGGGCCCAAAGTATCTTCCCAATTCCTTAAGGTTTCTGGAGTGGAGTTGGTATCCCTCCAAATGTCTGCCACCAAGTTTTCAACCTGTTGAGCTTGCTGAACTTCGTCTGCGGCATAGCAAAATTGATCACCTTTGGAATGGAATAAAGTACATGGTCAAGTTGAAATCTATTGATCTTAGTTACTCCGAGAACTTGACAAGGACCCCAGATTTCACAGCTACTCAGAATCTTGAGAGGCTGGTTTTTGAAGGTTGTACTAATCTTGTTAAGATTCATCCATCCATTGCCTCTCTCAAAAGACTGAGAGTTTTGAATTTTAAAAACTGTAAAAGCATTAAGAGTCTCCCGAGTGAAGTAGAACTGGAATCTCTTGAAACATTTGATCTTTCTGGGTGCTCAAAAGTGAAAAAGATTCCAGAATTTGTGGGAGAAATGAAGAATTTTTGGAAGTTTTCTATAAACTTCGCTGGTGTTGAGCAAATGCCTTCATCAATTATACCTTTGATCCCGAATTTGAAGGAGATTGATATGAGTGGAATTTCTATGAGAGATATGTCATCCGCCCTGGTTCCAGTGAAAAATATTGAACTGCCTAGATCATGGCATTCTTTCTTCAGTTTTGGCTTATTTCCAAGAAAGAATCCTGACCCTGTGAGTCTGGTGTTAGCTTCGTTAAAAGATTTACGCTTTTTGAAGCGTCTAAATCTGGAGGACTGCAATCTTTGTGAAGGAGCAATACCTGAAGATATTGGTTTATTGTCCTCTTTAGAAGATTTAAATCTTGATGGAAACCATTTTGTTAGCCTTCCTGCAAGCATCAGTGGGCTTTCTAAGCTTTGTAGGTTCACATTGAAGAATTGCAAAAGGCTTCAAAAATTGCCAAGCCTTCCATCAAACGGAGGACTACGTTTTCGTGTAAACACGCAGAATTGTACTTCCTTGAAAATATTCCCAGATCCACAATGGATGTGCAGCTTGTGTAGTACTATTTATATCCTTCCCTTGGTGCAGGAAATTCCTCGTTCTTTGATCTCCTTCAGTATTGTAATTCCTGGAAGTGAAATTCCTGAGTGGTTCAATAATCAAAGTGTGGGAGACCTACTAATTGAGACGCTACCTTCGGATTCTAATACCAAGTTTGTGGGGTTTGCTTTGTGTGCTCTATTTGTACCTGTCCACGAAATTTCAGCTACCGCTGAGGAACCAATGGGTCATTCAATCTATTTTCATTGCCGTTATGATTTAGAAACCAATGCGGGCCCCATTTTTATTATTCCAGTGGACGATGATGTAGCGTCCGATCACCTTTGGTTGATCCTCCTGTCTAGGCAACATTTCCCTTTGAAATCAAACTGGGGACCTGAAATCGAGATTCGGTTTCATTTCAAAGTAAGATCTAAACCTGGAAAGAAGACGTTGGTGAAGGGGAAGAAGTGTGGAGTCCGCGCACTGTATGAACAAGACGCGGAAGAGCTCAACCGAACAATGAAACAATATTCCAACAGAAAGAATTCTAACTCTTCCCATATTATCATATAA


Protein sequences

Name Description Sequence
ppa021490m disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

MASSSQRAFTSATAVCPWKYEVFLSFRGEDTRRGFTDYLFKQLDWRGIRTFRDDPDLERGTDINPELLTAIEQSRFAIIVLSTNYASSSWCLRELTHIVQSEMERIFPIFYYVDPSDVRHQRGSFGAALVNHERNCGEDREEVLEWRNALKKVANLAGRNSKDYRYDTELITEIVDAVWDKVHPTFSLYDSSEILVGFDTKLKEIDLHLDTSANDVRFVGIWGMGGMGKTTLARLVYERISHSFEGSSFLANVREVYATHGLVPLQKQLLSNILKKVNIQVCDAYSGFTMIKRCLCNKKVLLILDDVDQSEQLEMLIREKDCFGLGSRIIITTRDERLLVEQGIEKIYKVLPLTQHEARHLFSKKAFQKDDLEEDYLELSKSFIKYAGGLPLALKTLGSFLYKRSQDEWKSALDKLKQAPDRKILKILKISYDGLEEMQKKIFLDVACFHKCDDKEEVIEILDSCGFVGARIGIHVLIEKSLLSLSDKCVSMHDLIQEMAWEIVRQESFDEPGGRSRLWLYRDILHVLTNNMGTEAIEGIVLRLHEFEAAHWNPEAFTKMCKLKLLKINNFRLSLGPKYLPNSLRFLEWSWYPSKCLPPSFQPVELAELRLRHSKIDHLWNGIKYMVKLKSIDLSYSENLTRTPDFTATQNLERLVFEGCTNLVKIHPSIASLKRLRVLNFKNCKSIKSLPSEVELESLETFDLSGCSKVKKIPEFVGEMKNFWKFSINFAGVEQMPSSIIPLIPNLKEIDMSGISMRDMSSALVPVKNIELPRSWHSFFSFGLFPRKNPDPVSLVLASLKDLRFLKRLNLEDCNLCEGAIPEDIGLLSSLEDLNLDGNHFVSLPASISGLSKLCRFTLKNCKRLQKLPSLPSNGGLRFRVNTQNCTSLKIFPDPQWMCSLCSTIYILPLVQEIPRSLISFSIVIPGSEIPEWFNNQSVGDLLIETLPSDSNTKFVGFALCALFVPVHEISATAEEPMGHSIYFHCRYDLETNAGPIFIIPVDDDVASDHLWLILLSRQHFPLKSNWGPEIEIRFHFKVRSKPGKKTLVKGKKCGVRALYEQDAEELNRTMKQYSNRKNSNSSHIII*

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
8-159 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

AFTSATAVCPWKYEVFLSFRGEDTRRGFTDYLFKQLDWRGIRTFRDDPDLERGTDINPELLTAIEQSRFAIIVLSTNYASSSWCLRELTHIVQSEMERIFPIFYYVDPSDVRHQRGSFGAALVNHERNCGEDREEVLEWRNALKKVANLAGR

ProfileScan: PS50104
IPR000157
18-156 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYEVFLSFRGEDTRRGFTDYLFKQLDWRGIRTFRDDPDLERGTDINPELLTAIEQSRFAIIVLSTNYASSSWCLRELTHIVQSEMERIFPIFYYVDPSDVRHQRGSFGAALVNHERNCGEDREEVLEWRNALKKVANL

Gene3D: G3DSA:3.40.50.10140
18-152 no description

WKYEVFLSFRGEDTRRGFTDYLFKQLDWRGIRTFRDDPDLERGTDINPELLTAIEQSRFAIIVLSTNYASSSWCLRELTHIVQSEMERIFPIFYYVDPSDVRHQRGSFGAALVNHERNCGEDREEVLEWRNALKK

HMMSmart: SM00255
IPR000157
19-156 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYEVFLSFRGEDTRRGFTDYLFKQLDWRGIRTFRDDPDLERGTDINPELLTAIEQSRFAIIVLSTNYASSSWCLRELTHIVQSEMERIFPIFYYVDPSDVRHQRGSFGAALVNHERNCGEDREEVLEWRNALKKVANL

HMMPfam: PF01582
IPR000157
22-151 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRRGFTDYLFKQLDWRGIRTFRDDPDLERGTDINPELLTAIEQSRFAIIVLSTNYASSSWCLRELTHIVQSEMERIFPIFYYVDPSDVRHQRGSFGAALVNHERNCGEDREEVLEWRNALK

HMMPanther: PTHR11017
44-962 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DWRGIRTFRDDPDLERGTDINPELLTAIEQSRFAIIVLSTNYASSSWCLRELTHIVQSEMERIFPIFYYVDPSDVRHQRGSFGAALVNHERNCGEDREEVLEWRNALKKVANLAGRNSKDYRYDTELITEIVDAVWDKVHPTFSLYDSSEILVGFDTKLKEIDLHLDTSANDVRFVGIWGMGGMGKTTLARLVYERISHSFEGSSFLANVREVYATHGLVPLQKQLLSNILKKVNIQVCDAYSGFTMIKRCLCNKKVLLILDDVDQSEQLEMLIREKDCFGLGSRIIITTRDERLLVEQGIEKIYKVLPLTQHEARHLFSKKAFQKDDLEEDYLELSKSFIKYAGGLPLALKTLGSFLYKRSQDEWKSALDKLKQAPDRKILKILKISYDGLEEMQKKIFLDVACFHKCDDKEEVIEILDSCGFVGARIGIHVLIEKSLLSLSDKCVSMHDLIQEMAWEIVRQESFDEPGGRSRLWLYRDILHVLTNNMGTEAIEGIVLRLHEFEAAHWNPEAFTKMCKLKLLKINNFRLSLGPKYLPNSLRFLEWSWYPSKCLPPSFQPVELAELRLRHSKIDHLWNGIKYMVKLKSIDLSYSENLTRTPDFTATQNLERLVFEGCTNLVKIHPSIASLKRLRVLNFKNCKSIKSLPSEVELESLETFDLSGCSKVKKIPEFVGEMKNFWKFSINFAGVEQMPSSIIPLIPNLKEIDMSGISMRDMSSALVPVKNIELPRSWHSFFSFGLFPRKNPDPVSLVLASLKDLRFLKRLNLEDCNLCEGAIPEDIGLLSSLEDLNLDGNHFVSLPASISGLSKLCRFTLKNCKRLQKLPSLPSNGGLRFRVNTQNCTSLKIFPDPQWMCSLCSTIYILPLVQEIPRSLISFSIVIPGSEIPEWFNNQSVGDLLIETLPSDSNTKFVGFALCA

HMMPanther: PTHR11017:SF20
44-962 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DWRGIRTFRDDPDLERGTDINPELLTAIEQSRFAIIVLSTNYASSSWCLRELTHIVQSEMERIFPIFYYVDPSDVRHQRGSFGAALVNHERNCGEDREEVLEWRNALKKVANLAGRNSKDYRYDTELITEIVDAVWDKVHPTFSLYDSSEILVGFDTKLKEIDLHLDTSANDVRFVGIWGMGGMGKTTLARLVYERISHSFEGSSFLANVREVYATHGLVPLQKQLLSNILKKVNIQVCDAYSGFTMIKRCLCNKKVLLILDDVDQSEQLEMLIREKDCFGLGSRIIITTRDERLLVEQGIEKIYKVLPLTQHEARHLFSKKAFQKDDLEEDYLELSKSFIKYAGGLPLALKTLGSFLYKRSQDEWKSALDKLKQAPDRKILKILKISYDGLEEMQKKIFLDVACFHKCDDKEEVIEILDSCGFVGARIGIHVLIEKSLLSLSDKCVSMHDLIQEMAWEIVRQESFDEPGGRSRLWLYRDILHVLTNNMGTEAIEGIVLRLHEFEAAHWNPEAFTKMCKLKLLKINNFRLSLGPKYLPNSLRFLEWSWYPSKCLPPSFQPVELAELRLRHSKIDHLWNGIKYMVKLKSIDLSYSENLTRTPDFTATQNLERLVFEGCTNLVKIHPSIASLKRLRVLNFKNCKSIKSLPSEVELESLETFDLSGCSKVKKIPEFVGEMKNFWKFSINFAGVEQMPSSIIPLIPNLKEIDMSGISMRDMSSALVPVKNIELPRSWHSFFSFGLFPRKNPDPVSLVLASLKDLRFLKRLNLEDCNLCEGAIPEDIGLLSSLEDLNLDGNHFVSLPASISGLSKLCRFTLKNCKRLQKLPSLPSNGGLRFRVNTQNCTSLKIFPDPQWMCSLCSTIYILPLVQEIPRSLISFSIVIPGSEIPEWFNNQSVGDLLIETLPSDSNTKFVGFALCA

superfamily: SSF52540
177-424 P-loop containing nucleoside triphosphate hydrolases

AVWDKVHPTFSLYDSSEILVGFDTKLKEIDLHLDTSANDVRFVGIWGMGGMGKTTLARLVYERISHSFEGSSFLANVREVYATHGLVPLQKQLLSNILKKVNIQVCDAYSGFTMIKRCLCNKKVLLILDDVDQSEQLEMLIREKDCFGLGSRIIITTRDERLLVEQGIEKIYKVLPLTQHEARHLFSKKAFQKDDLEEDYLELSKSFIKYAGGLPLALKTLGSFLYKRSQDEWKSALDKLKQAPDRKI

HMMPfam: PF00931
IPR002182
200-469 NB-ARC,NBS
NB-ARC

TKLKEIDLHLDTSANDVRFVGIWGMGGMGKTTLARLVYERISHSFEGSSFLANVREVYATHGLVPLQKQLLSNILKKVNIQVCDAYSGFTMIKRCLCNKKVLLILDDVDQSEQLEMLIREKDCFGLGSRIIITTRDERLLVEQGIEKIYKVLPLTQHEARHLFSKKAFQKDDLEEDYLELSKSFIKYAGGLPLALKTLGSFLYKRSQDEWKSALDKLKQAPDRKILKILKISYDGLEEMQKKIFLDVACFHKCDDKEEVIEILDSCGFVG

Gene3D: G3DSA:3.40.50.300
215-335 no description

DVRFVGIWGMGGMGKTTLARLVYERISHSFEGSSFLANVREVYATHGLVPLQKQLLSNILKKVNIQVCDAYSGFTMIKRCLCNKKVLLILDDVDQSEQLEMLIREKDCFGLGSRIIITTRD

FPrintScan: PR00364
IPR000767
218-233 DISEASERSIST
Disease resistance protein

FVGIWGMGGMGKTTLA

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

CLCNKKVLLILDDVD

FPrintScan: PR00364
IPR000767
387-401 DISEASERSIST
Disease resistance protein

AGGLPLALKTLGSFL

superfamily: SSF52058
503-898 L domain-like,LRR

IVRQESFDEPGGRSRLWLYRDILHVLTNNMGTEAIEGIVLRLHEFEAAHWNPEAFTKMCKLKLLKINNFRLSLGPKYLPNSLRFLEWSWYPSKCLPPSFQPVELAELRLRHSKIDHLWNGIKYMVKLKSIDLSYSENLTRTPDFTATQNLERLVFEGCTNLVKIHPSIASLKRLRVLNFKNCKSIKSLPSEVELESLETFDLSGCSKVKKIPEFVGEMKNFWKFSINFAGVEQMPSSIIPLIPNLKEIDMSGISMRDMSSALVPVKNIELPRSWHSFFSFGLFPRKNPDPVSLVLASLKDLRFLKRLNLEDCNLCEGAIPEDIGLLSSLEDLNLDGNHFVSLPASISGLSKLCRFTLKNCKRLQKLPSLPSNGGLRFRVNTQNCTSLKIFPDPQWM

Gene3D: G3DSA:3.80.10.10
548-762 no description

EAAHWNPEAFTKMCKLKLLKINNFRLSLGPKYLPNSLRFLEWSWYPSKCLPPSFQPVELAELRLRHSKIDHLWNGIKYMVKLKSIDLSYSENLTRTPDFTATQNLERLVFEGCTNLVKIHPSIASLKRLRVLNFKNCKSIKSLPSEVELESLETFDLSGCSKVKKIPEFVGEMKNFWKFSINFAGVEQMPSSIIPLIPNLKEIDMSGISMRDMSS

Seg: seg
689-700 seg

SLPSEVELESLE

FPrintScan: PR00364
IPR000767
694-710 DISEASERSIST
Disease resistance protein

VELESLETFDLSGCSKV

Gene3D: G3DSA:3.80.10.10
797-870 no description

LASLKDLRFLKRLNLEDCNLCEGAIPEDIGLLSSLEDLNLDGNHFVSLPASISGLSKLCRFTLKNCKRLQKLPS

HMMPfam: PF00560
IPR001611
830-851 LRR_1
Leucine-rich repeat

SLEDLNLDGNHFVSLPASISGL

Seg: seg
1042-1055 seg

KPGKKTLVKGKKCG

Coil: coil
1057-1078 coiled-coil

RALYEQDAEELNRTMKQYSNRK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox