PRGDB00172598 (ppa024334m)

From PRG Wiki
Jump to: navigation, search
ppa024334m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type NBS
Gene Species Prunus persica

Comment?

Flavin-containing monooxygenase family protein (best arabidopsis hit)

DNA Sequence

ATGGAGCAAGTGGATGTTGTGATCGTAGGTGCTGGTCCTGCCGGCATTGCAACCTCTGCATGTCTCAACCGCCTTAATATTTCAAACGTTGTACTTGAAAGAGAAGATTGTTATGCTTCTCTTTGGAAGAAAAGGTCGTATGATCGTCTGAAGCTTCACTTGGCAAAGCAATTTTGCGAGCTTCCCCATATGCCATTTCCTCCAAATGCACCAAAGTATGTCCCCAAGGATCAGTTTGTTGAATACTTGGATTCTTATGTGTCTCATTTTAAGATACAACCTCTGTACCACCGTGTCGTGGAAACTGCTTTTTACGACGCAGATGTCGAAAAATGGCACGTCATTGTGAAAAACACATCTTTGGATGCTCAAGAAATTTACCTTGGTAAGTTTCTTGTGGTTGCAAGTGGTGAAAATAGTGAGGGTTATATTCCTCAAGTGCAAGGCCTGGATAGCTTTGGAGGGGAGTTCATGCATTCAAGTAAGTACGAAAATGGCAAGAAATATAGTGGAAAAAATGTTTTGGTTGTTGGTTGTGGGAACTCAGGCATGGAAATTGCTTATGATTTATCAAATTCGGGTGCAAATACTTCCATTGTTGTCCGTTCTCCGATACATGTTCTCACCAAGGAAATCGTGTTCCTTGGAATGGTGATGGCAAAATACATTCCTATTAATTTGGTCGACAACGTTATGGTTATCTTAAGCAAATTAAGGTTTGGAGATTTATCCAAGTATGGAATTCGAAGGCCCAAAAGTGGACCCTTTTTTCTCAAGGAAAAGGGTCAAGCCCCCATCATTGATGTAGGGAGCGTTAACAAGATCAGGACCGGAGAATTAAAGGTCGTTCCATCCATCACAAGCATCCAAGGAGACAATATCGAGTTTGAGAATGGCTGCAAAGACCGCTTTGATGCTATTGTATTTGCTACTGGCTACAAAAGCACTGTGCTAAATTGGCTCAAGGATGGGCACAATCTCTTCAATGACGATGGAATGCCGAAACAAAGTTTCCCAAATAACTGGAAAGGGAAGAACGGTCTTTACTGTGCTGGATTTTCTAGGCGTGGATTATTTGGCATTTCACATGATGCGCGAATGATAATAAGCGACATTAGCTTTGCTTTGGATCAGAACAAGAAAAAGAGTTAA


Protein sequences

Name Description Sequence
ppa024334m Flavin-containing monooxygenase family protein (best arabidopsis hit)

MEQVDVVIVGAGPAGIATSACLNRLNISNVVLEREDCYASLWKKRSYDRLKLHLAKQFCELPHMPFPPNAPKYVPKDQFVEYLDSYVSHFKIQPLYHRVVETAFYDADVEKWHVIVKNTSLDAQEIYLGKFLVVASGENSEGYIPQVQGLDSFGGEFMHSSKYENGKKYSGKNVLVVGCGNSGMEIAYDLSNSGANTSIVVRSPIHVLTKEIVFLGMVMAKYIPINLVDNVMVILSKLRFGDLSKYGIRRPKSGPFFLKEKGQAPIIDVGSVNKIRTGELKVVPSITSIQGDNIEFENGCKDRFDAIVFATGYKSTVLNWLKDGHNLFNDDGMPKQSFPNNWKGKNGLYCAGFSRRGLFGISHDARMIISDISFALDQNKKKS*

Domains

Domain Start-End Description Sequence

superfamily: SSF51905
1-343 FAD/NAD(P)-binding domain

MEQVDVVIVGAGPAGIATSACLNRLNISNVVLEREDCYASLWKKRSYDRLKLHLAKQFCELPHMPFPPNAPKYVPKDQFVEYLDSYVSHFKIQPLYHRVVETAFYDADVEKWHVIVKNTSLDAQEIYLGKFLVVASGENSEGYIPQVQGLDSFGGEFMHSSKYENGKKYSGKNVLVVGCGNSGMEIAYDLSNSGANTSIVVRSPIHVLTKEIVFLGMVMAKYIPINLVDNVMVILSKLRFGDLSKYGIRRPKSGPFFLKEKGQAPIIDVGSVNKIRTGELKVVPSITSIQGDNIEFENGCKDRFDAIVFATGYKSTVLNWLKDGHNLFNDDGMPKQSFPNNWK

Gene3D: G3DSA:3.50.50.60
2-184 no description

EQVDVVIVGAGPAGIATSACLNRLNISNVVLEREDCYASLWKKRSYDRLKLHLAKQFCELPHMPFPPNAPKYVPKDQFVEYLDSYVSHFKIQPLYHRVVETAFYDADVEKWHVIVKNTSLDAQEIYLGKFLVVASGENSEGYIPQVQGLDSFGGEFMHSSKYENGKKYSGKNVLVVGCGNSGM

FPrintScan: PR00469
IPR000103
5-27 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

DVVIVGAGPAGIATSACLNRLNI

HMMPanther: PTHR23023:SF5
5-373 MONOOXYGENASE,MONOOXYGENASE

DVVIVGAGPAGIATSACLNRLNISNVVLEREDCYASLWKKRSYDRLKLHLAKQFCELPHMPFPPNAPKYVPKDQFVEYLDSYVSHFKIQPLYHRVVETAFYDADVEKWHVIVKNTSLDAQEIYLGKFLVVASGENSEGYIPQVQGLDSFGGEFMHSSKYENGKKYSGKNVLVVGCGNSGMEIAYDLSNSGANTSIVVRSPIHVLTKEIVFLGMVMAKYIPINLVDNVMVILSKLRFGDLSKYGIRRPKSGPFFLKEKGQAPIIDVGSVNKIRTGELKVVPSITSIQGDNIEFENGCKDRFDAIVFATGYKSTVLNWLKDGHNLFNDDGMPKQSFPNNWKGKNGLYCAGFSRRGLFGISHDARMIISDIS

HMMPanther: PTHR23023
5-373 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

DVVIVGAGPAGIATSACLNRLNISNVVLEREDCYASLWKKRSYDRLKLHLAKQFCELPHMPFPPNAPKYVPKDQFVEYLDSYVSHFKIQPLYHRVVETAFYDADVEKWHVIVKNTSLDAQEIYLGKFLVVASGENSEGYIPQVQGLDSFGGEFMHSSKYENGKKYSGKNVLVVGCGNSGMEIAYDLSNSGANTSIVVRSPIHVLTKEIVFLGMVMAKYIPINLVDNVMVILSKLRFGDLSKYGIRRPKSGPFFLKEKGQAPIIDVGSVNKIRTGELKVVPSITSIQGDNIEFENGCKDRFDAIVFATGYKSTVLNWLKDGHNLFNDDGMPKQSFPNNWKGKNGLYCAGFSRRGLFGISHDARMIISDIS

FPrintScan: PR00368
IPR013027
6-25 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

VVIVGAGPAGIATSACLNRL

HMMPfam: PF00743
IPR020946
6-315 FMO-like
Flavin monooxygenase-like

VVIVGAGPAGIATSACLNRLNISNVVLEREDCYASLWKKRSYDRLKLHLAKQFCELPHMPFPPNAPKYVPKDQFVEYLDSYVSHFKIQPLYHRVVETAFYDADVEKWHVIVKNTSLDAQEIYLGKFLVVASGENSEGYIPQVQGLDSFGGEFMHSSKYENGKKYSGKNVLVVGCGNSGMEIAYDLSNSGANTSIVVRSPIHVLTKEIVFLGMVMAKYIPINLVDNVMVILSKLRFGDLSKYGIRRPKSGPFFLKEKGQAPIIDVGSVNKIRTGELKVVPSITSIQGDNIEFENGCKDRFDAIVFATGYKS

FPrintScan: PR00469
IPR000103
169-193 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

YSGKNVLVVGCGNSGMEIAYDLSNS

FPrintScan: PR00368
IPR013027
173-191 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

NVLVVGCGNSGMEIAYDLS

Gene3D: G3DSA:3.50.50.60
272-312 no description

VNKIRTGELKVVPSITSIQGDNIEFENGCKDRFDAIVFATG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox