PRGDB00172600 (ppa023909m)

From PRG Wiki
Jump to: navigation, search
ppa023909m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGACCCCTGGTTTTGCCTCCTCTTCATCCTCACCATCTTCCTCGTCAAAACGTTGGAAGTACCAAGTGTTCTTGAGCTTCAGAGGTGAAGACACACGCAAGGGCTTCACAGGCCACCTCCACGCCGCATTATCTGATGCCGGAATCCGCTCCTTTCTTGACGACGACGAGCTAAAAAGAGCGGAATTTATAAAAACCCAACTGGAGCAGGCAATCGACGGGTCCATGATCTCCATAATTGTCTTCTCCAAGAGTTATGCCGATTCCAGTTGGTGTCTTGACGAGCTGGTGAAGATCATGGAGTGTAGAGAAAGATTGGGGCAACAGGTTATTCCATTGTTCTATAATGTTGATGCTTCAGATGTCCGGAAACAAACTGGTAGGTTTGCGCAGGCATTTGAGAAACATGAAACGGGCATCTGTGAAGGTAAACATGAGAAAGAAAAGGTACAGCGGTGGAGAAATGCTCTCACTCAAGCTGCAAATTTGTGTGGGGAAGATCTTAATGCTGACAATGGGCATGAAGCAAAGTTTATCAAGAAAATTCTTGGGGAGGTTAATAAGCAGTTGTACAGCAAATACCAATTAGACATCGAACACCTTGTTGGAATTACTTCTCGGCTGAACGATGTTGTTCGCATGATTGATATTGAAAATTCAGGTTCTAAGGATGTTGTTCGCATGATTGGTATTTGGGGGATGGGCGGCATTGGGAAAACAACGCTTGCCAAAGCCATTTATAACAAATTTGAAGGTAGCTTTGAAGGTAGGAGTTTCCTTGCAAACGTGAGGGAAGTAATTGCAAACCAACCCATTACTGGTCTGGTTGGGTTGCAAGAAAAACTTCTAAATGATATCTTGAAAAGCAAGGATCCCATAAAGGTTGATTCTGTTGATGTAGGGATCACTGTGATACAAGAAAGACTTCACTGTAAAAGAGCACTGGTCATAATTGACGATGTAGATGAAGTACAGAAGCTAAAAGCAATAGCTAGAAAACGTGATTGGTTTGGTCCTGGAAGTAGAATTATTATAACAACAAGAGATAAACATTTGCTAGAGCAAATTGGAGTGGATGGCACATATATGGTTGAAGAAATGGATGAAAAAGAAGCTCTAGAGCTCTTTGGTTGGCATGCCTTTGAAAGTGGTTACCCTAATCAAGAATATCTTGACCTCTCAAAACGTGTAATTCGTTACTGTCGAGGCTTGCCACTAGCACTTGAAGTTGTAGGGTCTTTTCTGATTAAAAGATCCACAGTGGAGTGGGAAAATCATTTGGAGAAATTGGAAAGAAGTTCTGATGGAGATATTCAAAAAATACTCAGAATAAGCTTTGACGGGCTACCTGATGATACAATGAGAAAGATATTCCTTGATATATCTTGTTTCTTTATTGGAAAGGATAAGGACTATGTAACAAAAATATTAGATGGATGTGGCTTTTTTGCAACGATAGGAGTCAGTGTCCTCATTGAACGGTGCCTTGTAATTGCCAGTGAGCAAAACAAGCTGATGATGCATGATTTGCTTCGAGACATGGGAAGAGAGATCGTTCGTGAAAAATCCACCGGTCGTCCTGAAAATTTTAGTAGATTGTGGAAACGTGAAGACCTAACGGATGTATTGAGTGATGAATCTGGAACTGAAGAAATTGAAGGAGTTGCTCTAGATTTGCAACGAAATTTTCGTTGGAACAGATTCAGTGCACAAGCATTTACCAACATGAAAAAACTGAGGTTACTCCACCTCAGCGGAGTAGAGCTCACTGGAGAGTACAAAGATTTTCCCAAAAAGTTAATATGGTTGTCCTGGCATGGATTCCCTTTAAGGTCGATACCAGATGACTTTCCTATGCAACCAAAACTTGTTGCTTTAGACCTGCAGTATAGCGAACTCGAAATAGTTTGGAAGGATTGCGAGTTGCATCAGAATTTGAAAGTCCTTAATCTCAGTCATTCCTATCAGCTAACAAAATCACCAGACTTTTCAAAACTCCCAAATCTCGAGGAATTGATATTGCAATCCTGTTGGCGTTTGTCTGAGGTTCACTCATCCATCGGGAATCTAGGAAGACTTTCTTTGGTAAATCTTGAAGGCTGCGAAATGCTAAGGGATCTCCCACTGAATTTCTATAAATCCAAGTCTATTGAAACTCTTATACTTGATGGTTGTTGGAGATTTGAAAACTTGGCTGATGGCTTAGGGGACATGGTATCATTGAAGAAACTGAAAGTTTTATCTTTACGTTATGTGAAAAGATCGCCATCAACAAATCTTTTGCCTCCATTGCAAAGATTAAGCTTTTTAAGAGAATTAGCTCTTGCAGATTGCAGTTTAACTGATGATGCATTCCCCAAGGATCTCGGTAGCCTAATTTCCTTAGAAAATTTAAATCTTGCAAGCAATGACTTTTTCAGCCTACCAAGCCTCAGTCGTCTTTCACGGCTTCAAGATTTGTCTTTAGATAATTGCAAATATCTTCGTGCAATCCCAGATTTACCAACAAATTTGAAAGTCTTACAAGCACATGGCTGCTTTTCATTGAAAAAAATGCCAGATTTTTCAGAAATATGGACTTCTTGCGGATTTGGTGGAATTTTTCTCGGAGGAAATGACATTCCTGATTGGTTCCACTGTGTCAATGACGATGATAATGTGTATTTCACTGTGCCTCAAAGTGTTGGTCGTAATTTGAAAGGGTTAACTTTGTCCTTCGGTTTCTCTTCCTCTTCATATTGGGTCCCTTGTCGTTTTCGCATTAGCATTAAAAACGTCACCGGGGGTACTGAGCTTGATGCCAGGATCATACCCGACTATGACAATAATAAAGGTACTGGTTATTATCTTTGGCAGGGACAGTTATCAAATGACGAGCTCAAATTGCAAGACGGTGATAAAGTCTGGATTGAAATAATAGTGGACAAATGGGTGAAGGTGAAGAAAATAGGTGTTAGTCTGACAGGATTCTTTGCCATTGCTATGGCAGATGTGTTGTCACACAGAATTGGTGTGCCTTCCACTTGCTCCTCTCCAAAATCTTCAAGTATAAACCTTAGCCATTTAGCTTGTGATGTTGCTTCAGCAGCACTCACATATTCTGCTTCAGCAGTAGACAAAGCTACTGTATTTTGTTTGATTGAGGCCCAAGAAAACATGCCAGATCCCAGAGTGAACACATATCCTGATGTACTTCTTCTGTCATCTTCACTGCCTGCCCAGTCACTGTCACAGTAG


Protein sequences

Name Description Sequence
ppa023909m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

MTPGFASSSSSPSSSSKRWKYQVFLSFRGEDTRKGFTGHLHAALSDAGIRSFLDDDELKRAEFIKTQLEQAIDGSMISIIVFSKSYADSSWCLDELVKIMECRERLGQQVIPLFYNVDASDVRKQTGRFAQAFEKHETGICEGKHEKEKVQRWRNALTQAANLCGEDLNADNGHEAKFIKKILGEVNKQLYSKYQLDIEHLVGITSRLNDVVRMIDIENSGSKDVVRMIGIWGMGGIGKTTLAKAIYNKFEGSFEGRSFLANVREVIANQPITGLVGLQEKLLNDILKSKDPIKVDSVDVGITVIQERLHCKRALVIIDDVDEVQKLKAIARKRDWFGPGSRIIITTRDKHLLEQIGVDGTYMVEEMDEKEALELFGWHAFESGYPNQEYLDLSKRVIRYCRGLPLALEVVGSFLIKRSTVEWENHLEKLERSSDGDIQKILRISFDGLPDDTMRKIFLDISCFFIGKDKDYVTKILDGCGFFATIGVSVLIERCLVIASEQNKLMMHDLLRDMGREIVREKSTGRPENFSRLWKREDLTDVLSDESGTEEIEGVALDLQRNFRWNRFSAQAFTNMKKLRLLHLSGVELTGEYKDFPKKLIWLSWHGFPLRSIPDDFPMQPKLVALDLQYSELEIVWKDCELHQNLKVLNLSHSYQLTKSPDFSKLPNLEELILQSCWRLSEVHSSIGNLGRLSLVNLEGCEMLRDLPLNFYKSKSIETLILDGCWRFENLADGLGDMVSLKKLKVLSLRYVKRSPSTNLLPPLQRLSFLRELALADCSLTDDAFPKDLGSLISLENLNLASNDFFSLPSLSRLSRLQDLSLDNCKYLRAIPDLPTNLKVLQAHGCFSLKKMPDFSEIWTSCGFGGIFLGGNDIPDWFHCVNDDDNVYFTVPQSVGRNLKGLTLSFGFSSSSYWVPCRFRISIKNVTGGTELDARIIPDYDNNKGTGYYLWQGQLSNDELKLQDGDKVWIEIIVDKWVKVKKIGVSLTGFFAIAMADVLSHRIGVPSTCSSPKSSSINLSHLACDVASAALTYSASAVDKATVFCLIEAQENMPDPRVNTYPDVLLLSSSLPAQSLSQ*

Domains

Domain Start-End Description Sequence

Seg: seg
7-16 seg

SSSSSPSSSS

superfamily: SSF52200
IPR000157
9-166 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

SSSPSSSSKRWKYQVFLSFRGEDTRKGFTGHLHAALSDAGIRSFLDDDELKRAEFIKTQLEQAIDGSMISIIVFSKSYADSSWCLDELVKIMECRERLGQQVIPLFYNVDASDVRKQTGRFAQAFEKHETGICEGKHEKEKVQRWRNALTQAANLCGE

Gene3D: G3DSA:3.40.50.10140
16-160 no description

SKRWKYQVFLSFRGEDTRKGFTGHLHAALSDAGIRSFLDDDELKRAEFIKTQLEQAIDGSMISIIVFSKSYADSSWCLDELVKIMECRERLGQQVIPLFYNVDASDVRKQTGRFAQAFEKHETGICEGKHEKEKVQRWRNALTQA

ProfileScan: PS50104
IPR000157
19-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYQVFLSFRGEDTRKGFTGHLHAALSDAGIRSFLDDDELKRAEFIKTQLEQAIDGSMISIIVFSKSYADSSWCLDELVKIMECRERLGQQVIPLFYNVDASDVRKQTGRFAQAFEKHETGICEGKHEKEKVQRWRNALTQAANL

HMMSmart: SM00255
IPR000157
20-163 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYQVFLSFRGEDTRKGFTGHLHAALSDAGIRSFLDDDELKRAEFIKTQLEQAIDGSMISIIVFSKSYADSSWCLDELVKIMECRERLGQQVIPLFYNVDASDVRKQTGRFAQAFEKHETGICEGKHEKEKVQRWRNALTQAANL

HMMPfam: PF01582
IPR000157
23-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKGFTGHLHAALSDAGIRSFLDDDELKRAEFIKTQLEQAIDGSMISIIVFSKSYADSSWCLDELVKIMECRERLGQQVIPLFYNVDASDVRKQTGRFAQAFEKHETGICEGKHEKEKVQRWRNALT

HMMPanther: PTHR11017:SF20
54-854 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DDDELKRAEFIKTQLEQAIDGSMISIIVFSKSYADSSWCLDELVKIMECRERLGQQVIPLFYNVDASDVRKQTGRFAQAFEKHETGICEGKHEKEKVQRWRNALTQAANLCGEDLNADNGHEAKFIKKILGEVNKQLYSKYQLDIEHLVGITSRLNDVVRMIDIENSGSKDVVRMIGIWGMGGIGKTTLAKAIYNKFEGSFEGRSFLANVREVIANQPITGLVGLQEKLLNDILKSKDPIKVDSVDVGITVIQERLHCKRALVIIDDVDEVQKLKAIARKRDWFGPGSRIIITTRDKHLLEQIGVDGTYMVEEMDEKEALELFGWHAFESGYPNQEYLDLSKRVIRYCRGLPLALEVVGSFLIKRSTVEWENHLEKLERSSDGDIQKILRISFDGLPDDTMRKIFLDISCFFIGKDKDYVTKILDGCGFFATIGVSVLIERCLVIASEQNKLMMHDLLRDMGREIVREKSTGRPENFSRLWKREDLTDVLSDESGTEEIEGVALDLQRNFRWNRFSAQAFTNMKKLRLLHLSGVELTGEYKDFPKKLIWLSWHGFPLRSIPDDFPMQPKLVALDLQYSELEIVWKDCELHQNLKVLNLSHSYQLTKSPDFSKLPNLEELILQSCWRLSEVHSSIGNLGRLSLVNLEGCEMLRDLPLNFYKSKSIETLILDGCWRFENLADGLGDMVSLKKLKVLSLRYVKRSPSTNLLPPLQRLSFLRELALADCSLTDDAFPKDLGSLISLENLNLASNDFFSLPSLSRLSRLQDLSLDNCKYLRAIPDLPTNLKVLQAHGCFSLKKMPD

HMMPanther: PTHR11017
54-854 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DDDELKRAEFIKTQLEQAIDGSMISIIVFSKSYADSSWCLDELVKIMECRERLGQQVIPLFYNVDASDVRKQTGRFAQAFEKHETGICEGKHEKEKVQRWRNALTQAANLCGEDLNADNGHEAKFIKKILGEVNKQLYSKYQLDIEHLVGITSRLNDVVRMIDIENSGSKDVVRMIGIWGMGGIGKTTLAKAIYNKFEGSFEGRSFLANVREVIANQPITGLVGLQEKLLNDILKSKDPIKVDSVDVGITVIQERLHCKRALVIIDDVDEVQKLKAIARKRDWFGPGSRIIITTRDKHLLEQIGVDGTYMVEEMDEKEALELFGWHAFESGYPNQEYLDLSKRVIRYCRGLPLALEVVGSFLIKRSTVEWENHLEKLERSSDGDIQKILRISFDGLPDDTMRKIFLDISCFFIGKDKDYVTKILDGCGFFATIGVSVLIERCLVIASEQNKLMMHDLLRDMGREIVREKSTGRPENFSRLWKREDLTDVLSDESGTEEIEGVALDLQRNFRWNRFSAQAFTNMKKLRLLHLSGVELTGEYKDFPKKLIWLSWHGFPLRSIPDDFPMQPKLVALDLQYSELEIVWKDCELHQNLKVLNLSHSYQLTKSPDFSKLPNLEELILQSCWRLSEVHSSIGNLGRLSLVNLEGCEMLRDLPLNFYKSKSIETLILDGCWRFENLADGLGDMVSLKKLKVLSLRYVKRSPSTNLLPPLQRLSFLRELALADCSLTDDAFPKDLGSLISLENLNLASNDFFSLPSLSRLSRLQDLSLDNCKYLRAIPDLPTNLKVLQAHGCFSLKKMPD

superfamily: SSF52540
183-438 P-loop containing nucleoside triphosphate hydrolases

LGEVNKQLYSKYQLDIEHLVGITSRLNDVVRMIDIENSGSKDVVRMIGIWGMGGIGKTTLAKAIYNKFEGSFEGRSFLANVREVIANQPITGLVGLQEKLLNDILKSKDPIKVDSVDVGITVIQERLHCKRALVIIDDVDEVQKLKAIARKRDWFGPGSRIIITTRDKHLLEQIGVDGTYMVEEMDEKEALELFGWHAFESGYPNQEYLDLSKRVIRYCRGLPLALEVVGSFLIKRSTVEWENHLEKLERSSDGDI

Gene3D: G3DSA:3.40.50.300
199-356 no description

EHLVGITSRLNDVVRMIDIENSGSKDVVRMIGIWGMGGIGKTTLAKAIYNKFEGSFEGRSFLANVREVIANQPITGLVGLQEKLLNDILKSKDPIKVDSVDVGITVIQERLHCKRALVIIDDVDEVQKLKAIARKRDWFGPGSRIIITTRDKHLLEQI

HMMPfam: PF00931
IPR002182
223-483 NB-ARC,NBS
NB-ARC

KDVVRMIGIWGMGGIGKTTLAKAIYNKFEGSFEGRSFLANVREVIANQPITGLVGLQEKLLNDILKSKDPIKVDSVDVGITVIQERLHCKRALVIIDDVDEVQKLKAIARKRDWFGPGSRIIITTRDKHLLEQIGVDGTYMVEEMDEKEALELFGWHAFESGYPNQEYLDLSKRVIRYCRGLPLALEVVGSFLIKRSTVEWENHLEKLERSSDGDIQKILRISFDGLPDDTMRKIFLDISCFFIGKDKDYVTKILDGCGFF

Seg: seg
228-238 seg

MIGIWGMGGIG

FPrintScan: PR00364
IPR000767
228-243 DISEASERSIST
Disease resistance protein

MIGIWGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
308-322 DISEASERSIST
Disease resistance protein

RLHCKRALVIIDDVD

FPrintScan: PR00364
IPR000767
401-415 DISEASERSIST
Disease resistance protein

CRGLPLALEVVGSFL

superfamily: SSF52058
506-853 L domain-like,LRR

MMHDLLRDMGREIVREKSTGRPENFSRLWKREDLTDVLSDESGTEEIEGVALDLQRNFRWNRFSAQAFTNMKKLRLLHLSGVELTGEYKDFPKKLIWLSWHGFPLRSIPDDFPMQPKLVALDLQYSELEIVWKDCELHQNLKVLNLSHSYQLTKSPDFSKLPNLEELILQSCWRLSEVHSSIGNLGRLSLVNLEGCEMLRDLPLNFYKSKSIETLILDGCWRFENLADGLGDMVSLKKLKVLSLRYVKRSPSTNLLPPLQRLSFLRELALADCSLTDDAFPKDLGSLISLENLNLASNDFFSLPSLSRLSRLQDLSLDNCKYLRAIPDLPTNLKVLQAHGCFSLKKMP

Gene3D: G3DSA:3.80.10.10
557-641 no description

LDLQRNFRWNRFSAQAFTNMKKLRLLHLSGVELTGEYKDFPKKLIWLSWHGFPLRSIPDDFPMQPKLVALDLQYSELEIVWKDCE

Gene3D: G3DSA:3.80.10.10
642-844 no description

LHQNLKVLNLSHSYQLTKSPDFSKLPNLEELILQSCWRLSEVHSSIGNLGRLSLVNLEGCEMLRDLPLNFYKSKSIETLILDGCWRFENLADGLGDMVSLKKLKVLSLRYVKRSPSTNLLPPLQRLSFLRELALADCSLTDDAFPKDLGSLISLENLNLASNDFFSLPSLSRLSRLQDLSLDNCKYLRAIPDLPTNLKVLQAH

ProfileScan: PS51450
IPR001611
645-667 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKVLNLSHSYQLTKSPDFSKLP

Seg: seg
739-754 seg

VSLKKLKVLSLRYVKR

ProfileScan: PS51450
IPR001611
794-815 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLENLNLASNDFFSLPSLSRLS

Seg: seg
807-823 seg

SLPSLSRLSRLQDLSLD

FPrintScan: PR00364
IPR000767
812-828 DISEASERSIST
Disease resistance protein

SRLSRLQDLSLDNCKYL

ProfileScan: PS51450
IPR001611
816-838 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLQDLSLDNCKYLRAIPDLPTNL

Seg: seg
901-912 seg

GLTLSFGFSSSS

Seg: seg
967-985 seg

KVWIEIIVDKWVKVKKIGV

Seg: seg
1007-1016 seg

STCSSPKSSS

Seg: seg
1065-1077 seg

LLLSSSLPAQSLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox