PRGDB00172603 (ppa019762m)

From PRG Wiki
Jump to: navigation, search
ppa019762m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGTTTTCTCTGCTTGCTCTTCTCCTCCACTTATCATCCTTTCACTCTCTGTCTCTAGCTTATGAGCTCCCAGATGAGAATTTCATCAATTGTGGATCAGATGCTGCTATAAACTTTACTGGCAGGACGTTCATTGCAGATGATTACTTCTCCTCACAGAAAAGCAAGGCTGTCAAAGCCAGCAACCAGCTTCCAGATAATATATCAACTCTCTACCAAACAGCAAGAATTTTCAGCCAGCAATCCTACTATAAGTTCGAGATTAGTGAAAACGGTACTTATTTTGTACGCCTGCATTTCTTGGCTTTCTCCTCCTCAGTTAATCTCTCCACAGCTTTTTTTGATGTTCTGGCTTTTCCTAATGTTTCAAATTCTGGGTTCAAACTGTTGAGCAATTTCACTGCTAAGAATAGTAGCAACTCTCCTTTGATAAAGGAGTTCTTCCTTGGGATTGATCCTGGCACGTTTAAAATATATTTTGTTCCTCAAGCATCATCTTTTGCATTTGTAAATGCCATTGAAGTCTTCCTTGCTCCTGCAAGTTTCAGCCCTGAGAATTACAACAGTAGTCTTCCTTTAGTTCTGCATACAATTTACAGGGTGAATGTTGGAGGCCAGAAAATCACACCAGATAATGACAAAAGATGGAGAAACTGGGAACAAGATGATAGGTATCTGTCTGATCCAAACTCTGCCAAGGAATTCCACTACCCGGGGGAGCCTAGTTATTACAATAATGGAGAGCTTAATGATCCAGTCACTCATTTCATTGCTGCTAATGATTTTATTGCCCCGGATTCTGTTTACCGAACTGCCAAAGAGATGAATATTACTCCTAGCAGGCCATTCAATTCCTTCAACATAACCTGGTCTTTTAATGCGGCGAGAAGAAACGCTAGGCACCTTGTCCGGGTTCACTTCTGTGACATTATTGGTCAACCTGGTAATATAGTATTTAATTTATACTCAAATGGCAACTTCAGTAAGAAGGTTGGTGGAAGTCAGTCCTTATTCGATACACAGTCGGGTACTCCTTTCTACTATGATTTTGTGGTGAGTTCTAATGAGTCTCAACACATTAGCATCAGCGTAGGCGCTCGGACAAACTCTACAAACAAAACTGCCTTTCTGAATGGTCTGGAAATGTTGGAGATAATGGAGGGCTCAGTTTCAGTTTCTGATGTGAAAGAGTCTGTGAAGAAAAATGTGGGTCTTGTGGTTGGTTCGGTTGTTGGAAGCCTGTCTTTCATCTGCATTTTGGCTTTCGGAATCTTGTTTGGTTTGAAACACATAAGAAGGTTGACTGCGATTCGTGGGCTGAAGATATCATTTGCTGAAGTTCAGCGTGCAACAAACAACTTTGACGATGAGAAGCTGCTTGGTGAAGGTGGCTTTGGGAATGTTTACAGAGGAACTCTCCTCGATGGAAGAGAAGTAGCTGTCAAGAGAGCTAAGAAAGGTTCAGGCCAAGGCCTTCGAGAATTCCATACAGAGATCAAGATTTTGTCCAAGATTCACCATCGCCATCTTGTTTCCTTAATTGGGTACTGTGATCAAAAGTCTGAGATGATAATTGTCTATGAGTTCATGGAAAATGGGACCTTGACAGATCACTTATATGGTTCGGACTTGCCACGTATGCCTTGGAAGCAGAGACTTGAAATTTGCCTTGGTGCAGCAAGGGGTCTGGATTACCTCCACACAGTTGCAGCTGGGGCCATCATTCACCGTGATGTTAAGTCCAACAACATATTGCTTGATAAATATAATGTTGCTAAAGTTGCTGACTTTGGCCTTTCAAAACATGGTTCTGTTGATGAAACTCATGTCGTCACCAAAGTGAAAGGCACCCTTGGTTACCTTGATCCGGACTACATGATGTCCGAACAGTTGTCTGAAAAATCTGATGTGTACTCGTTCGGGGTAGTTCTTCTTGAGGTGTTATGTGGAAGACCTCCTATTGATGGAAATCTCCCAAGAGATGAAATGAACTTAGCTGAATGGGTTCTACATTGCAAGACGAAAGGGTTGCTTGAACAGGTTGTAGACTCTTCACTTGAGGGTCAGATTGATGCTAACTCGCTGCGAGTATTTAGTGACACGGCTGAGAAATGTCTCCGAAAAGAAGTTAATGATCGGCCTACAATGGGTAATGTGCTGTCTGACTTGGAATATGCATTAAGGCTCCATCTAGCACTAAATCCTAGAGAACTTAGTTCTGAGGACAGCACAGCCAATGCTTCATCAGCATTCATAAATGTTGAGCGTCTTCCTTCACTTAGTTCCACAGTTAACGCAGACGATACAGCTGTCTCCGCGGTCGGATCGGTGGACACAACACCAAGCCAAGTTTTCTCCCAGTTGAAGTTTGGCGATGCCAGATAA


Protein sequences

Name Description Sequence
ppa019762m Protein kinase superfamily protein (best arabidopsis hit)

MFSLLALLLHLSSFHSLSLAYELPDENFINCGSDAAINFTGRTFIADDYFSSQKSKAVKASNQLPDNISTLYQTARIFSQQSYYKFEISENGTYFVRLHFLAFSSSVNLSTAFFDVLAFPNVSNSGFKLLSNFTAKNSSNSPLIKEFFLGIDPGTFKIYFVPQASSFAFVNAIEVFLAPASFSPENYNSSLPLVLHTIYRVNVGGQKITPDNDKRWRNWEQDDRYLSDPNSAKEFHYPGEPSYYNNGELNDPVTHFIAANDFIAPDSVYRTAKEMNITPSRPFNSFNITWSFNAARRNARHLVRVHFCDIIGQPGNIVFNLYSNGNFSKKVGGSQSLFDTQSGTPFYYDFVVSSNESQHISISVGARTNSTNKTAFLNGLEMLEIMEGSVSVSDVKESVKKNVGLVVGSVVGSLSFICILAFGILFGLKHIRRLTAIRGLKISFAEVQRATNNFDDEKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIGYCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLSDLEYALRLHLALNPRELSSEDSTANASSAFINVERLPSLSSTVNADDTAVSAVGSVDTTPSQVFSQLKFGDAR*

Domains

Domain Start-End Description Sequence

Seg: seg
2-20 seg

FSLLALLLHLSSFHSLSLA

HMMPfam: PF11721
IPR021720
28-101 Malectin
Malectin

FINCGSDAAINFTGRTFIADDYFSSQKSKAVKASNQLPDNISTLYQTARIFSQQSYYKFEISENGTYFVRLHFL

HMMPanther: PTHR24420:SF785
345-791 SUBFAMILY NOT NAMED

PFYYDFVVSSNESQHISISVGARTNSTNKTAFLNGLEMLEIMEGSVSVSDVKESVKKNVGLVVGSVVGSLSFICILAFGILFGLKHIRRLTAIRGLKISFAEVQRATNNFDDEKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIGYCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLSDLEYALRLHLALNPRELSSEDSTANASSAFINVERLPSLSSTVNADDTAVSAVGSVDTTPSQVFSQLKFG

HMMPanther: PTHR24420
345-791 FAMILY NOT NAMED,FAMILY NOT NAMED

PFYYDFVVSSNESQHISISVGARTNSTNKTAFLNGLEMLEIMEGSVSVSDVKESVKKNVGLVVGSVVGSLSFICILAFGILFGLKHIRRLTAIRGLKISFAEVQRATNNFDDEKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIGYCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLSDLEYALRLHLALNPRELSSEDSTANASSAFINVERLPSLSSTVNADDTAVSAVGSVDTTPSQVFSQLKFG

Seg: seg
389-401 seg

SVSVSDVKESVKK

Seg: seg
403-415 seg

VGLVVGSVVGSLS

superfamily: SSF56112
IPR011009
440-721 Protein kinase-like (PK-like)
Protein kinase-like domain

LKISFAEVQRATNNFDDEKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIGYCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLS

Gene3D: G3DSA:3.30.200.20
442-515 no description

ISFAEVQRATNNFDDEKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIG

HMMSmart: SM00219
IPR020635
454-723 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDDEKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIGYCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLSDL

ProfileScan: PS50011
IPR000719
454-733 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDDEKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIGYCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLSDLEYALRLHLAL

HMMSmart: SM00220
IPR002290
454-726 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDDEKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIGYCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLSDLEYA

HMMPfam: PF00069
IPR000719
457-721 Pkinase,Ser-thr
Protein kinase, catalytic domain

EKLLGEGGFGNVYRGTLLDGREVAVKRAKKGSGQGLREFHTEIKILSKIHHRHLVSLIGYCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLS

PatternScan: PS00107
IPR017441
460-486 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGNVYRGTLLDGREVAVKRAKK

Gene3D: G3DSA:1.10.510.10
516-722 no description

YCDQKSEMIIVYEFMENGTLTDHLYGSDLPRMPWKQRLEICLGAARGLDYLHTVAAGAIIHRDVKSNNILLDKYNVAKVADFGLSKHGSVDETHVVTKVKGTLGYLDPDYMMSEQLSEKSDVYSFGVVLLEVLCGRPPIDGNLPRDEMNLAEWVLHCKTKGLLEQVVDSSLEGQIDANSLRVFSDTAEKCLRKEVNDRPTMGNVLSD

PatternScan: PS00108
IPR008271
574-586 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSNNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox