PRGDB00172606 (ppa002615m)

From PRG Wiki
Jump to: navigation, search
ppa002615m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Prunus persica

Comment?

cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (best arabidopsis hit)

DNA Sequence

ATGCTTTTCACAATTATAACACTATTGATGCCGGCTAGCCTTTCTGCTGTAGACCCTCTTTCAATCTTTTGTTCAACTGATGCCAGAAACTACACTCCCAATAGCCAATTTGAAAACAATCTCAAGCAGCTCCTTGAGTCATTGTCTTTCAACACTTCCATCTCAGGCGGCTTCTACAACGACACGATCGGAGATGGCCCTAGCATGGTCTATGGACAATCACTTTGTAGATGGGATGTTAACTCCACAGTTTGTCAAAACTGTGTCAATGAAGCAAGCCAAGAAATCTTCAAGAGCTGTAAAGCAACAGATGCAATGATATGGTATGAATTCTGTCAAATTCAATATTCTTACCAGATATCCTTTTCATTGATGGTTTATACTGGAAAATATCCAGACAAGAATAATGAGGAGAAGACTGTATCAAATCCACATCATTTCAAGGATGTATTGATGTATTTAATGAGGAACCTCTCGGGAGAGGCTGCGTTTAATTCTTCAAAGCATATGTTTGCAACTGGGAAAGTTAAATATTCAGAAAAGTATACTATTTATGGTCTACAACAATGCACTAGAGACATCTCTGAAAGTAACTGCAATAATTGTTTGAATTCTGCTCTTGCTGATCTTTCGGAATGCTGCTCTTCTCACCAAGGTGGAACTGTTGTTAGTAGGAATTGTAATGTGAGGTTTGAACTGTACTCATTTTTTAACGACACGTCGAGTTCTCTGTTAAATTTCCCATATTCCAAAGGGGATAAATGGAAGACTTGGAAGGTGGTGGCTACATGTGCATCCATCATACTATTAGTGGTCATTTCATTTTATGCTTTCCATCGTCGGATGAAAAAGGGATTAGAAAACATCGAAGATGAAGAAAAAAGTGAGCAAGTACTATTACATGATTTGACAAGCCCCACTGGAGTCACAATCACAGTAGAAGGCAAATTCGTAAGTTCTGAGGAGCTAGCCTTCATAGATCTAGCTACTATAAAAATAGCAACTAATGACTTCTCAGATTCAAATAAGCTTGGACAAGGTGGGTTTGGTACTGTTTACAAGGGTTTGCTACCAGATGGGAAAGAAGTAGCTGTTAAAAGACTGTCAAGGAAGTCATGGCAAGGCTTGGAGGAGTTTAAGAATGAGGTCATACTCATTGCAAAACTTCAACACAGAAACCTTGTGCGGCTCTTGGCATGTGGCTTTGAGGGAGAGGAAAAGCTGCTGTTGTATGAGTTCATGCCAAATAAAAGCCTAGATGTCTTCATCTTTGATTCGGAAAGACGAGCTGAACTCAATTGGAAAATATATTACAGCATTATTGAAGGCATTGCCAGAGGACTTCTGTATCTCCATGAGGACTCGCGGCTCAAAATCATTCACAGGGATTTGAAGCCCAGCAATGTCCTGTTGGACCATGAAATGGTTGCCAAAATATCAGACTTTGGCATGGCAAGGATCTTTTGTGAAAACCAGAACACAGCTAACACTAAAAAAGTTGTAGGAACGTATGGCTACATGGCTCCGGAGTATGCAATGGAGGGTCTATTTTCTGTAAAATCTGATGTTTACAGCTTTGGGGTAATCTTGCTAGAGATTATTAGTGGGAAAAGGAATAGTGGGTTCTATCTCACAGAACATGCCAAGACACTCGTTGCATATGCATGGAGACTATGGAAAGATGGAAAAGAATTGGAATTTGTGGAACCTTTGTTGATGGAATCTTGGCCAACAGCAGAGGTTTTGAAATGCATGCACATTGCGCTTTTATGTGTCCAGGAAGACCCTGAAGAGAGGCCTACAATGTCAGCTGTGGTTGTATTGCTTGGAAGTGAATCAATAGATCTTCCTGAGCCAAAGCAACCGGCAATATTTTCCGTAGGTAGAATTCCAATTGGCGAGTCTAAAACTGATCCTACTTCAAACGGGCTCACTCTTTCTATTGTTTCGCCACGGTGA


Protein sequences

Name Description Sequence
ppa002615m cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (best arabidopsis hit)

MLFTIITLLMPASLSAVDPLSIFCSTDARNYTPNSQFENNLKQLLESLSFNTSISGGFYNDTIGDGPSMVYGQSLCRWDVNSTVCQNCVNEASQEIFKSCKATDAMIWYEFCQIQYSYQISFSLMVYTGKYPDKNNEEKTVSNPHHFKDVLMYLMRNLSGEAAFNSSKHMFATGKVKYSEKYTIYGLQQCTRDISESNCNNCLNSALADLSECCSSHQGGTVVSRNCNVRFELYSFFNDTSSSLLNFPYSKGDKWKTWKVVATCASIILLVVISFYAFHRRMKKGLENIEDEEKSEQVLLHDLTSPTGVTITVEGKFVSSEELAFIDLATIKIATNDFSDSNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEFMPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVVLLGSESIDLPEPKQPAIFSVGRIPIGESKTDPTSNGLTLSIVSPR*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
IPR002902
19-121 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

PLSIFCSTDARNYTPNSQFENNLKQLLESLSFNTSISGGFYNDTIGDGPSMVYGQSLCRWDVNSTVCQNCVNEASQEIFKSCKATDAMIWYEFCQIQYSYQIS

HMMPfam: PF01657
IPR002902
23-119 Stress-antifung
Gnk2-homologous domain

FCSTDARNYTPNSQFENNLKQLLESLSFNTSISGGFYNDTIGDGPSMVYGQSLCRWDVNSTVCQNCVNEASQEIFKSCKATDAMIWYEFCQIQYSYQ

ProfileScan: PS51473
IPR002902
129-236 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

GKYPDKNNEEKTVSNPHHFKDVLMYLMRNLSGEAAFNSSKHMFATGKVKYSEKYTIYGLQQCTRDISESNCNNCLNSALADLSECCSSHQGGTVVSRNCNVRFELYSF

HMMPfam: PF01657
IPR002902
135-236 Stress-antifung
Gnk2-homologous domain

NNEEKTVSNPHHFKDVLMYLMRNLSGEAAFNSSKHMFATGKVKYSEKYTIYGLQQCTRDISESNCNNCLNSALADLSECCSSHQGGTVVSRNCNVRFELYSF

HMMPanther: PTHR24420:SF430
183-625 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TIYGLQQCTRDISESNCNNCLNSALADLSECCSSHQGGTVVSRNCNVRFELYSFFNDTSSSLLNFPYSKGDKWKTWKVVATCASIILLVVISFYAFHRRMKKGLENIEDEEKSEQVLLHDLTSPTGVTITVEGKFVSSEELAFIDLATIKIATNDFSDSNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEFMPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVVLLGSESIDLPEPKQPAIF

HMMPanther: PTHR24420
183-625 FAMILY NOT NAMED,FAMILY NOT NAMED

TIYGLQQCTRDISESNCNNCLNSALADLSECCSSHQGGTVVSRNCNVRFELYSFFNDTSSSLLNFPYSKGDKWKTWKVVATCASIILLVVISFYAFHRRMKKGLENIEDEEKSEQVLLHDLTSPTGVTITVEGKFVSSEELAFIDLATIKIATNDFSDSNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEFMPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVVLLGSESIDLPEPKQPAIF

superfamily: SSF56112
IPR011009
308-617 Protein kinase-like (PK-like)
Protein kinase-like domain

GVTITVEGKFVSSEELAFIDLATIKIATNDFSDSNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEFMPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVVLLGSESIDLP

Gene3D: G3DSA:3.30.200.20
321-413 no description

EELAFIDLATIKIATNDFSDSNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEF

HMMSmart: SM00220
IPR002290
338-609 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDSNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEFMPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVVLL

HMMSmart: SM00219
IPR020635
338-609 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDSNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEFMPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVVLL

ProfileScan: PS50011
IPR000719
338-614 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDSNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEFMPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVVLLGSESI

HMMPfam: PF07714
IPR001245
341-607 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SNKLGQGGFGTVYKGLLPDGKEVAVKRLSRKSWQGLEEFKNEVILIAKLQHRNLVRLLACGFEGEEKLLLYEFMPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVV

PatternScan: PS00107
IPR017441
344-366 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGTVYKGLLPDGKEVAVK

Gene3D: G3DSA:1.10.510.10
414-610 no description

MPNKSLDVFIFDSERRAELNWKIYYSIIEGIARGLLYLHEDSRLKIIHRDLKPSNVLLDHEMVAKISDFGMARIFCENQNTANTKKVVGTYGYMAPEYAMEGLFSVKSDVYSFGVILLEIISGKRNSGFYLTEHAKTLVAYAWRLWKDGKELEFVEPLLMESWPTAEVLKCMHIALLCVQEDPEERPTMSAVVVLLG

PatternScan: PS00108
IPR008271
459-471 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox