PRGDB00172615 (ppa001497m)

From PRG Wiki
Jump to: navigation, search
ppa001497m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Prunus persica

Comment?

Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGGCAGTGGATTTAGTCGGAGGGGGTACTTTTAGAGTAGCATTTCAAATGCTATTTGATGCTGTTATAGCAGTGAAGAAGGAGACTACCATGTTTAAATCCATGCTTGGAGATATCAAATCCACACTGGACTCTTTACAGCCAGTGATCAAAGAGAGAGAAAAATATGACTCAAAGGAGGGGCTAGAAAATTTTGCAATGCAAATGGAGGAGGGGGTAAAGCTTGTTTACAAATGCAGCAAGGTTGGTGTGTGGAGCTGGTGCAGAAAATACAGATACACCAGAAAGCTTGATGAATTGGATAAATGTCTTCAAAGACTAGTGGAGGTGTTGAAAGTGCAGGGCATAAGGGATGTCAAGGAGACCTTGGTTTCTTTGAGGAATATAGAGACGGTGCTGCATCGAATTGAAGGGAACTTGGTGATGCAAAACCAACCTGAAAAAATCAATGGTTGGTCTTCAGTGCCTGAACCTCCACCGGTTACAGTTGGGTTGGATGTGCCATTGAAAGAATTGAAGATAAAGCTTCTTAAGGATGATGTGTCAATGCTTGTGCTGACTGCTGCTGGTGGATGTGGGAAAACCACATTGGCAAAAAAGTTTTGTCAAGATCAGGAAGTTAAAGATAAATTCAAGAACAATATCTTCTTCGTCACTCTTTCAAAAAATCCCAACTTGGACCTTATTGTACATGAGCTATATCAACGCAAGGGTTCCCAGGTGCCTGCTTTCGAAAATGAAGTAATTGCAGTTTACTGGTTGCAACTATTTCTGAAGGAAACATCACAAAATCCTGTACTGTTTGTCCTGGATGATGTTTGGTCAGGATCAGAGTCCCTACTTGAGAAGTTTGATGAATTCAAAATGACAAATTACAAAGTTTTGGTCACATCAAGAATTGCATTTCCAAGATTTGGTTCTCCATATCATTTGGAATTCTTGAATGATGAAGATGCAATGGCTCTTTTTCATCATTCAGCATTTTTGGAGGATAAGAGCTCTTATGCTCGGGAAGATCTTTCGAGAAAGATAATAAAGCTATGTAAGGGATTTCCACTTGCGATTACAGCGGTTGGAAGATCACTTCGCGGCCAACCTATAGAGATCTGGCGAAAAAGAGTAATGGAATGGTCTAAAGGTTCTTCTATACTTGCGTCAAACAATGATTTGCTTGCTTGCCTCAAAAGCAGCATAGATGCCTTGGATAAAGAAAAGCCTACCCTCAAGGAATGTTTCCTTGACCTTTGCTCATTTCCTAAAGATCAAAGGATCTCTGCTGCCACCCTCATAGATATGTGGGCAGAGTTATATGGCCTAGACGAACCTAGTCTGTCCATTGCAAACCTCTACGAACTAACCACCCAGAGTTTAGCTAATCTTATAGCCACAAGGAATGAGCGGGAGGCTGATGGCTATTACACTGAACGCTTTGTTACTCAGCCTGATATGCTTAGAGAGTTGGCTATCCATCAGGCGAGCCAGGACCCAATAGGACAGAGAAAAAGACTGATTATAGACATACGTGGAGATAATCTTCCTAACTGGCTGACAGAGGCAAAGCATCAGCCCATGCAGGCTCGACTATTATCTATCTCAACTGATGGGGCCTTCTCAAAAAAATGGCCAAACATGCAACTACCAAAAGCAGAGGTTCTAGTTCTAAATTTTGAAACAAACAGCTACGACTTACCTGAATTTGTGACGAAAATGGATAAATTAAAGGTTCTAATAGTCACAAATTTCAGTTTCTTACCTGCCGAATTAAATAATTTTCAACTACTTGGTTCATCATCAAATCTGAAGAGAATTAGATTGGAACGCATTTCAATTCCTTCAATAAGCAAGAACATCAAACAGTTGGAAAGTGTACAGAAGATATCTTTGTTCATGTGTAGCATCGGTCAAGCTTTTGGTAAAGGTTCCATCAACATTTTAGATGCATTGCCAAATCTAGGCGAAATGGACATAGATTGTTGCCATGAGCTGGTGGAGTTGCCTGTCGAGGTTTGTGATCTCATTCACCTTAAGAAGCTTAGCATCACCAACTGTCATAACCTATCCGCCTTGCCTGAAAAGATCGGAAAGTTACTCAGTTTGGAAGTGTTGAGGCTTAGGTCTTGTACAGACTTGTTAGAGTTGCCAAGCTCGATTAGGAACCTCAAAAAGTTAAACTTTCTTGACATATCCTTTTGCTTTAGCATTACGCAGTTGCCTGAACACATTGGTGAGATTTGCAGTTTAAAAAAGCTCAACATGAGACAATGCTCAAGATTGCAAGATCTCCCTGCATCAGTTTTGGACCTTGAGCAGTTGAAGGATGTGATATGTGATGAAGAGACAGAACTTTTATGGGAACCCTTCTTACCCTTTCTCAAAAACATACACATAAAGGTGGTCAAAGAAGATAACAACCTAAATTGGCTCCACAAGCTTCGATCTTGA


Protein sequences

Name Description Sequence
ppa001497m Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit)

MAVDLVGGGTFRVAFQMLFDAVIAVKKETTMFKSMLGDIKSTLDSLQPVIKEREKYDSKEGLENFAMQMEEGVKLVYKCSKVGVWSWCRKYRYTRKLDELDKCLQRLVEVLKVQGIRDVKETLVSLRNIETVLHRIEGNLVMQNQPEKINGWSSVPEPPPVTVGLDVPLKELKIKLLKDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKNNIFFVTLSKNPNLDLIVHELYQRKGSQVPAFENEVIAVYWLQLFLKETSQNPVLFVLDDVWSGSESLLEKFDEFKMTNYKVLVTSRIAFPRFGSPYHLEFLNDEDAMALFHHSAFLEDKSSYAREDLSRKIIKLCKGFPLAITAVGRSLRGQPIEIWRKRVMEWSKGSSILASNNDLLACLKSSIDALDKEKPTLKECFLDLCSFPKDQRISAATLIDMWAELYGLDEPSLSIANLYELTTQSLANLIATRNEREADGYYTERFVTQPDMLRELAIHQASQDPIGQRKRLIIDIRGDNLPNWLTEAKHQPMQARLLSISTDGAFSKKWPNMQLPKAEVLVLNFETNSYDLPEFVTKMDKLKVLIVTNFSFLPAELNNFQLLGSSSNLKRIRLERISIPSISKNIKQLESVQKISLFMCSIGQAFGKGSINILDALPNLGEMDIDCCHELVELPVEVCDLIHLKKLSITNCHNLSALPEKIGKLLSLEVLRLRSCTDLLELPSSIRNLKKLNFLDISFCFSITQLPEHIGEICSLKKLNMRQCSRLQDLPASVLDLEQLKDVICDEETELLWEPFLPFLKNIHIKVVKEDNNLNWLHKLRS*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-145 RPW8
Powdery mildew resistance protein, RPW8 domain

MAVDLVGGGTFRVAFQMLFDAVIAVKKETTMFKSMLGDIKSTLDSLQPVIKEREKYDSKEGLENFAMQMEEGVKLVYKCSKVGVWSWCRKYRYTRKLDELDKCLQRLVEVLKVQGIRDVKETLVSLRNIETVLHRIEGNLVMQNQ

HMMPfam: PF05659
IPR008808
3-137 RPW8
Powdery mildew resistance protein, RPW8 domain

VDLVGGGTFRVAFQMLFDAVIAVKKETTMFKSMLGDIKSTLDSLQPVIKEREKYDSKEGLENFAMQMEEGVKLVYKCSKVGVWSWCRKYRYTRKLDELDKCLQRLVEVLKVQGIRDVKETLVSLRNIETVLHRIE

HMMPanther: PTHR23155:SF239
101-771 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

DKCLQRLVEVLKVQGIRDVKETLVSLRNIETVLHRIEGNLVMQNQPEKINGWSSVPEPPPVTVGLDVPLKELKIKLLKDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKNNIFFVTLSKNPNLDLIVHELYQRKGSQVPAFENEVIAVYWLQLFLKETSQNPVLFVLDDVWSGSESLLEKFDEFKMTNYKVLVTSRIAFPRFGSPYHLEFLNDEDAMALFHHSAFLEDKSSYAREDLSRKIIKLCKGFPLAITAVGRSLRGQPIEIWRKRVMEWSKGSSILASNNDLLACLKSSIDALDKEKPTLKECFLDLCSFPKDQRISAATLIDMWAELYGLDEPSLSIANLYELTTQSLANLIATRNEREADGYYTERFVTQPDMLRELAIHQASQDPIGQRKRLIIDIRGDNLPNWLTEAKHQPMQARLLSISTDGAFSKKWPNMQLPKAEVLVLNFETNSYDLPEFVTKMDKLKVLIVTNFSFLPAELNNFQLLGSSSNLKRIRLERISIPSISKNIKQLESVQKISLFMCSIGQAFGKGSINILDALPNLGEMDIDCCHELVELPVEVCDLIHLKKLSITNCHNLSALPEKIGKLLSLEVLRLRSCTDLLELPSSIRNLKKLNFLDISFCFSITQLPEHIGEICSLKKLNMRQCSRLQDLPASVLDLEQL

HMMPanther: PTHR23155
101-771 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DKCLQRLVEVLKVQGIRDVKETLVSLRNIETVLHRIEGNLVMQNQPEKINGWSSVPEPPPVTVGLDVPLKELKIKLLKDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKNNIFFVTLSKNPNLDLIVHELYQRKGSQVPAFENEVIAVYWLQLFLKETSQNPVLFVLDDVWSGSESLLEKFDEFKMTNYKVLVTSRIAFPRFGSPYHLEFLNDEDAMALFHHSAFLEDKSSYAREDLSRKIIKLCKGFPLAITAVGRSLRGQPIEIWRKRVMEWSKGSSILASNNDLLACLKSSIDALDKEKPTLKECFLDLCSFPKDQRISAATLIDMWAELYGLDEPSLSIANLYELTTQSLANLIATRNEREADGYYTERFVTQPDMLRELAIHQASQDPIGQRKRLIIDIRGDNLPNWLTEAKHQPMQARLLSISTDGAFSKKWPNMQLPKAEVLVLNFETNSYDLPEFVTKMDKLKVLIVTNFSFLPAELNNFQLLGSSSNLKRIRLERISIPSISKNIKQLESVQKISLFMCSIGQAFGKGSINILDALPNLGEMDIDCCHELVELPVEVCDLIHLKKLSITNCHNLSALPEKIGKLLSLEVLRLRSCTDLLELPSSIRNLKKLNFLDISFCFSITQLPEHIGEICSLKKLNMRQCSRLQDLPASVLDLEQL

superfamily: SSF52540
144-376 P-loop containing nucleoside triphosphate hydrolases

NQPEKINGWSSVPEPPPVTVGLDVPLKELKIKLLKDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKNNIFFVTLSKNPNLDLIVHELYQRKGSQVPAFENEVIAVYWLQLFLKETSQNPVLFVLDDVWSGSESLLEKFDEFKMTNYKVLVTSRIAFPRFGSPYHLEFLNDEDAMALFHHSAFLEDKSSYAREDLSRKIIKLCKGFPLAITAVGRSLRGQPIEIWRKRVME

Seg: seg
169-178 seg

LKELKIKLLK

HMMPfam: PF00931
IPR002182
170-434 NB-ARC,NBS
NB-ARC

KELKIKLLKDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKNNIFFVTLSKNPNLDLIVHELYQRKGSQVPAFENEVIAVYWLQLFLKETSQNPVLFVLDDVWSGSESLLEKFDEFKMTNYKVLVTSRIAFPRFGSPYHLEFLNDEDAMALFHHSAFLEDKSSYAREDLSRKIIKLCKGFPLAITAVGRSLRGQPIEIWRKRVMEWSKGSSILASNNDLLACLKSSIDALDKEKPTLKECFLDLCSFPKDQRISAATLIDMWA

Gene3D: G3DSA:3.40.50.300
178-288 no description

KDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKNNIFFVTLSKNPNLDLIVHELYQRKGSQVPAFENEVIAVYWLQLFLKETSQNPVLFVLDDVWSGSESLLEKFDEFK

FPrintScan: PR00364
IPR000767
183-198 DISEASERSIST
Disease resistance protein

MLVLTAAGGCGKTTLA

FPrintScan: PR00364
IPR000767
260-274 DISEASERSIST
Disease resistance protein

ETSQNPVLFVLDDVW

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CKGFPLAITAVGRSL

superfamily: SSF52058
479-778 L domain-like,LRR

TQPDMLRELAIHQASQDPIGQRKRLIIDIRGDNLPNWLTEAKHQPMQARLLSISTDGAFSKKWPNMQLPKAEVLVLNFETNSYDLPEFVTKMDKLKVLIVTNFSFLPAELNNFQLLGSSSNLKRIRLERISIPSISKNIKQLESVQKISLFMCSIGQAFGKGSINILDALPNLGEMDIDCCHELVELPVEVCDLIHLKKLSITNCHNLSALPEKIGKLLSLEVLRLRSCTDLLELPSSIRNLKKLNFLDISFCFSITQLPEHIGEICSLKKLNMRQCSRLQDLPASVLDLEQLKDVICDE

Gene3D: G3DSA:3.80.10.10
545-773 no description

QLPKAEVLVLNFETNSYDLPEFVTKMDKLKVLIVTNFSFLPAELNNFQLLGSSSNLKRIRLERISIPSISKNIKQLESVQKISLFMCSIGQAFGKGSINILDALPNLGEMDIDCCHELVELPVEVCDLIHLKKLSITNCHNLSALPEKIGKLLSLEVLRLRSCTDLLELPSSIRNLKKLNFLDISFCFSITQLPEHIGEICSLKKLNMRQCSRLQDLPASVLDLEQLKD

FPrintScan: PR00364
IPR000767
718-734 DISEASERSIST
Disease resistance protein

RNLKKLNFLDISFCFSI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox