PRGDB00172616 (ppa008280m)

From PRG Wiki
Jump to: navigation, search
ppa008280m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

cinnamoyl coa reductase 1 (best arabidopsis hit)

DNA Sequence

ATGCCTGCCGATAGCTCTTCAGTTTCAGGCCATGGCCAAACTGTTTGTGTCACCGGAGCTGGAGGCTTCATTGCTTCCTGGATTGTCAAACTGTTGCTAGAAAGAGGCTACATTGTTAGGGGAACCTTGAGAAACCCAGATGACCCAAAGAATGCTCATTTGAGGGAGCTTGAAGGAGCTCAAGATAGGTTGACTTTACGTAAAGCTGATCTTCTTGACTTTGAGAGCCTTAAAGAAGCCATCAACGGCTGTGATGGCGTTTTTCACACAGCATCACCGGTTACGGATGACCCAGAACAAATGATGGAGCCTGCGGTGAATGGAACGAAAAATGTGATTGTTGCAGCAGCAGAAGCCAAGGTTAAAAGGGTTGTGTTCACGTCGTCAATTGGTACAGTGTACATGAACCCCACCAGGAGCCCTGATGTGGTGGTCGATGAGTCATGTTGGAGCAACCTTGAATATTGCAAGAACACCAAGAACTGGTACTGCTATGCGAAAACAGTGGCAGAGCAGACAGCTTGGGAAGAGGCCAAGGAGAAAGGGGTGGATTTGGTGGTGGTGAACCCAGTTTTGGTACTCGGACCACTTCTCCAACCAACCGTCAACGCCAGCATCATCCACATCCTCAAGTACCTCACAGGCTCAGCCAAGACTTATGCCAATGCTGTGCAGGCCTATGTGCATGTTAGGGACGTGGCTGTGGCCCACATTCTGGTGTATGAAACTCCATCTGCCTCGGGAAGGTACCTTTGTGGTGAGAGTGTGCTTCACCGTGGAGACGTGGTAGAAATCCTAGCCAAGTTCTTCCCAGAATACCCAATTCCCACCAAGTGCTCGGATGAAGTCAAACCAAGAGTAAAACCATACAAGTTGACAACCCAGAAGCTACAAGACTTGGGCGTGGAGTTCATTCCAGTGAAACAGTGCCTATATGAAACTGTTAAGAGCTTGCAGGAGAAGGGCCACCTTCCAGTGCCTAAACCACAAGAAGATTCCATTAAAATTCAATCTTAA


Protein sequences

Name Description Sequence
ppa008280m cinnamoyl coa reductase 1 (best arabidopsis hit)

MPADSSSVSGHGQTVCVTGAGGFIASWIVKLLLERGYIVRGTLRNPDDPKNAHLRELEGAQDRLTLRKADLLDFESLKEAINGCDGVFHTASPVTDDPEQMMEPAVNGTKNVIVAAAEAKVKRVVFTSSIGTVYMNPTRSPDVVVDESCWSNLEYCKNTKNWYCYAKTVAEQTAWEEAKEKGVDLVVVNPVLVLGPLLQPTVNASIIHILKYLTGSAKTYANAVQAYVHVRDVAVAHILVYETPSASGRYLCGESVLHRGDVVEILAKFFPEYPIPTKCSDEVKPRVKPYKLTTQKLQDLGVEFIPVKQCLYETVKSLQEKGHLPVPKPQEDSIKIQS*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366
1-337 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MPADSSSVSGHGQTVCVTGAGGFIASWIVKLLLERGYIVRGTLRNPDDPKNAHLRELEGAQDRLTLRKADLLDFESLKEAINGCDGVFHTASPVTDDPEQMMEPAVNGTKNVIVAAAEAKVKRVVFTSSIGTVYMNPTRSPDVVVDESCWSNLEYCKNTKNWYCYAKTVAEQTAWEEAKEKGVDLVVVNPVLVLGPLLQPTVNASIIHILKYLTGSAKTYANAVQAYVHVRDVAVAHILVYETPSASGRYLCGESVLHRGDVVEILAKFFPEYPIPTKCSDEVKPRVKPYKLTTQKLQDLGVEFIPVKQCLYETVKSLQEKGHLPVPKPQEDSIKIQ

HMMPanther: PTHR10366:SF9
1-337 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

MPADSSSVSGHGQTVCVTGAGGFIASWIVKLLLERGYIVRGTLRNPDDPKNAHLRELEGAQDRLTLRKADLLDFESLKEAINGCDGVFHTASPVTDDPEQMMEPAVNGTKNVIVAAAEAKVKRVVFTSSIGTVYMNPTRSPDVVVDESCWSNLEYCKNTKNWYCYAKTVAEQTAWEEAKEKGVDLVVVNPVLVLGPLLQPTVNASIIHILKYLTGSAKTYANAVQAYVHVRDVAVAHILVYETPSASGRYLCGESVLHRGDVVEILAKFFPEYPIPTKCSDEVKPRVKPYKLTTQKLQDLGVEFIPVKQCLYETVKSLQEKGHLPVPKPQEDSIKIQ

Gene3D: G3DSA:3.40.50.720
IPR016040
12-271 no description
NAD(P)-binding domain

GQTVCVTGAGGFIASWIVKLLLERGYIVRGTLRNPDDPKNAHLRELEGAQDRLTLRKADLLDFESLKEAINGCDGVFHTASPVTDDPEQMMEPAVNGTKNVIVAAAEAKVKRVVFTSSIGTVYMNPTRSPDVVVDESCWSNLEYCKNTKNWYCYAKTVAEQTAWEEAKEKGVDLVVVNPVLVLGPLLQPTVNASIIHILKYLTGSAKTYANAVQAYVHVRDVAVAHILVYETPSASGRYLCGESVLHRGDVVEILAKFFP

superfamily: SSF51735
12-320 NAD(P)-binding Rossmann-fold domains

GQTVCVTGAGGFIASWIVKLLLERGYIVRGTLRNPDDPKNAHLRELEGAQDRLTLRKADLLDFESLKEAINGCDGVFHTASPVTDDPEQMMEPAVNGTKNVIVAAAEAKVKRVVFTSSIGTVYMNPTRSPDVVVDESCWSNLEYCKNTKNWYCYAKTVAEQTAWEEAKEKGVDLVVVNPVLVLGPLLQPTVNASIIHILKYLTGSAKTYANAVQAYVHVRDVAVAHILVYETPSASGRYLCGESVLHRGDVVEILAKFFPEYPIPTKCSDEVKPRVKPYKLTTQKLQDLGVEFIPVKQCLYETVKSLQE

HMMPfam: PF01370
IPR001509
15-253 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFIASWIVKLLLERGYIVRGTLRNPDDPKNAHLRELEGAQDRLTLRKADLLDFESLKEAINGCDGVFHTASPVTDDPEQMMEPAVNGTKNVIVAAAEAKVKRVVFTSSIGTVYMNPTRSPDVVVDESCWSNLEYCKNTKNWYCYAKTVAEQTAWEEAKEKGVDLVVVNPVLVLGPLLQPTVNASIIHILKYLTGSAKTYANAVQAYVHVRDVAVAHILVYETPSASGRYLCG

Seg: seg
110-125 seg

KNVIVAAAEAKVKRVV

Seg: seg
183-202 seg

VDLVVVNPVLVLGPLLQPTV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox