PRGDB00172618 (ppa015767m)

From PRG Wiki
Jump to: navigation, search
ppa015767m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

receptor like protein 6 (best arabidopsis hit)

DNA Sequence

ATGGAGAAGGCTTGTTCGGTGCATTGTGCTTTCTGTGAAGATGCCATGGAAAACTGTTGCTGGCCATTAGAGATAGGCATGCGTCAGACTCTGCCTATGGAGCTTCAAAAGTGTATTAAAAACCAACAACTATCATTGCTCCAATTGAAGAAAAGCCTTACATTTTATAATGATTCATCTGGATATTCTCCACTTTCGTCAACCAAGGTCATATCATGGAATTCAAGTACAGACTGCTGCTCTTGGGTTGGTGTTACTTGCAGTACAAGTGGGCATGTTGTTGGTCTTGACATTAGCAGCGAATGCATCACGGGTGGGATTGACAATTCGAGCAGTCTCTTCGATCTCCAACATCTTCAAATCCTTAACTTGGCCAACAACAAACTTGGCAGTGTGGACCATAGCATTCCATCTGCAATCGGAAAGCTCACGGATTTGAGGTATCTAAATTTGTCCAAAACTGATTATTCAGGGCAAATTCCAATTGAGATTTCACGCCTGAAAAAGTTGGTTGTCCTTGATATTTCTAACATTTACAACTCCCTTAAGATCCCGAATTTACGCATGCTCTTTCATAATCTCACAGAGCTTACAGAGCTATATCTTGATGATGTAGATATATCAGCACAGGGGGCTCAGTGGTGCGAAGCAATATCATCTTCACTGCCAAACCTGAGGGTGTTAAGCATGTCTGGAACTAATCTCTCAGGTCCTATTGATCAATCCCTGGCTAAAATTCAGTCTTTATCCGTGATTCGATTGGATTTTAACTATATCTCCGGATTCTTTGCCAATTATTCAAAGTTGTCTTCCTTGAGTCTCAAATATTGTCAGTTGCAAGGATCATTTCCCAAAGAGATCTTTCAGGTACCTACTCTACAAAATATCGACCTTTCGCATAATTTGGATCTTGAAGGCTCCTTGCCAGAATTTCCAAAGAATGGATCTCTTCGATCCTTGATACTGAGATGGACAAACTTTTCAGGCTTCTTGCCCAACTCTATTGGAAACCTCAAAATGTTGTCCACGATAGATCTTTCAGGTTGCAGCTTCACTGGATCAATCCCAAAGTCAATGGAAAACCTGACAGAATTGGTTAGCCTGTACATGCCATCGCAGAGGCTTCAAGGTCCGGTAGACTTTATTCACTGGGAAAACCTTGTTAATCTGGTACATCTCCAACTGGAATTCAATCTCCTAAATGGGAGTATTCCATCATCTATTTTTTCTTCTCCCGTGTTAAAGGAACTACTACTTTCCCACAATCAATTTTCTGGTCAACTCCATGAATTTCATAACGTTTCTTCCAACTTAATTACCCTTGATTTGAGTTTCAACAATTTGGAAGGACCAATACCCGTGTCTATCTTGAGTTTTCGAGGGCTTTATACACTTGATCTTTCTTCAAACAATTTCACTCGCTTTCCTTTTAATGGTCCTCAGCAACTGAGAAATCTTTCGACCATTGATCTTTCCCACAATAGCTTGCTGGTTTTATATAATGGTTCCAGTTCCTCATCTTCCTCTTTTCCTCAAATTCAGGATATGAACTTGGCTTCTAACAAGTTGAGAACATTCCCAAATTTCTTGAGAAATCACATCTATTTAGAACGTTTGGACCTCTCAGAAAACCAGATTCAAGGCATGGTTCCCAATTGGATTTGGGGGATAAGTTCTCTTTCTCAGCTAAATCTTTCATCCAACTCCTTCTCAACTCTCGAAAGGCCTTTACCTAAAAATTCCAGTGTGTCTGCTCTCGACCTTCATTCAAACCAACTTCAGGGGCAAATCCCATTTTTCTCACCAAGTGCCCGTTATCTGGATTATTCAAAAAATTGTTTCAGCTCTAGCATACCAACTGACATTGGTGATTTCCTTGCTTCCACTGTGTTCCTCTCTCTTTCAAGCAATAACTTGCATGGGCTCATTCCAGTATCAATATGCAATGCAGGTTATGAGGTTCTTGATATGTCCAATAACTCTTTAAGTGGTATGGTTCCCCAATGCTTGACTGAAATGAAGAGTCTTAGAGTACTTATTTTAAGGAAAAACAACCTTAATGGAACTCTTTCTAACAGATTTACTGGATATTGTGGTTTAAGAGCTCTAGACCTCGGAAGGAATCAGATTAAAGGCCAGCTTCCAAAATCTCTAGCCAGTTGCACAAATTTAGAGATTCTAAACCTTGGAAACAATCAAATCATAGATACTTTTCCATGCTTCTTGAAGAGCATATCCACCTTGCGTGTCCTTGTTTTGCGATCCAACAGATTTTATGGCGGCATCGGATGTTCGAAGACCAATGGCACCTGGCAAATGCTTCAAATTGTAGACCTAGCTCACAACAACTTCAATGGTGAAATACCGGAAAGATCCTTGACAACATGGCAGGCAATGACGGCTGACGAAGATGGTTCCCGACCAAAGAGCAATGTCCTTTCATCTGAAGGGGGACAGTATACTGGAGCTGTTTATTCTTTTAAGGATGCTATAACAGTTACTAGTAAAGGTTCAGAGATGGATCTCGTAAAGATTCTAACTATCTTCACCTTGATTGACTTCTCGGACAACAAATTCAACGGATCAATACCTGAGGAAATGGGAGTATTGAAATCACTGTATATCCTCAACTTGTCCAGTAATGCCATCACAGGCGAAATCCCATCAAGCTTAGGCAACATGCGGCAACTTGAGTCCTTGGACCTGTCGCAAAACAAGCTGAGCGGGCACATTCCCCAACAGTTGACAAAGCTTACTTTCCTCGCATTCTTGAATCTCTCAAACAATCAACTGGGAGGCATGATCCCAACCAGTAATCAGTTTTCAACATTTCCACCATCCTCCTTTACAGGTAACAAAGGATTATCGGGACCTCCTTTGGACAACAAAACAGGATTGCCGCCGCCACCGCCAACACGGAATGGAAGCCTTCCGGATTCTGGATCTGGACATAATGAGATTGATTGGGATCTTATTAGCATCGAAATCGGATTTACATTTGGGTGTGCAATTGCCATTGGGTCACTTGTGTTCTGCAAGAGATGGAGTAAATGGTATTACAGAGCCATGTATAGCATCCTTGTCAAGATATTCCCTCAGCTGGAGGAAAGACTTGGTAACCATAGAAGACATGTTCACATAAATCAAAGGTGGAGACGTTGA


Protein sequences

Name Description Sequence
ppa015767m receptor like protein 6 (best arabidopsis hit)

MEKACSVHCAFCEDAMENCCWPLEIGMRQTLPMELQKCIKNQQLSLLQLKKSLTFYNDSSGYSPLSSTKVISWNSSTDCCSWVGVTCSTSGHVVGLDISSECITGGIDNSSSLFDLQHLQILNLANNKLGSVDHSIPSAIGKLTDLRYLNLSKTDYSGQIPIEISRLKKLVVLDISNIYNSLKIPNLRMLFHNLTELTELYLDDVDISAQGAQWCEAISSSLPNLRVLSMSGTNLSGPIDQSLAKIQSLSVIRLDFNYISGFFANYSKLSSLSLKYCQLQGSFPKEIFQVPTLQNIDLSHNLDLEGSLPEFPKNGSLRSLILRWTNFSGFLPNSIGNLKMLSTIDLSGCSFTGSIPKSMENLTELVSLYMPSQRLQGPVDFIHWENLVNLVHLQLEFNLLNGSIPSSIFSSPVLKELLLSHNQFSGQLHEFHNVSSNLITLDLSFNNLEGPIPVSILSFRGLYTLDLSSNNFTRFPFNGPQQLRNLSTIDLSHNSLLVLYNGSSSSSSSFPQIQDMNLASNKLRTFPNFLRNHIYLERLDLSENQIQGMVPNWIWGISSLSQLNLSSNSFSTLERPLPKNSSVSALDLHSNQLQGQIPFFSPSARYLDYSKNCFSSSIPTDIGDFLASTVFLSLSSNNLHGLIPVSICNAGYEVLDMSNNSLSGMVPQCLTEMKSLRVLILRKNNLNGTLSNRFTGYCGLRALDLGRNQIKGQLPKSLASCTNLEILNLGNNQIIDTFPCFLKSISTLRVLVLRSNRFYGGIGCSKTNGTWQMLQIVDLAHNNFNGEIPERSLTTWQAMTADEDGSRPKSNVLSSEGGQYTGAVYSFKDAITVTSKGSEMDLVKILTIFTLIDFSDNKFNGSIPEEMGVLKSLYILNLSSNAITGEIPSSLGNMRQLESLDLSQNKLSGHIPQQLTKLTFLAFLNLSNNQLGGMIPTSNQFSTFPPSSFTGNKGLSGPPLDNKTGLPPPPPTRNGSLPDSGSGHNEIDWDLISIEIGFTFGCAIAIGSLVFCKRWSKWYYRAMYSILVKIFPQLEERLGNHRRHVHINQRWRR*


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
38-1019 FAMILY NOT NAMED,FAMILY NOT NAMED

CIKNQQLSLLQLKKSLTFYNDSSGYSPLSSTKVISWNSSTDCCSWVGVTCSTSGHVVGLDISSECITGGIDNSSSLFDLQHLQILNLANNKLGSVDHSIPSAIGKLTDLRYLNLSKTDYSGQIPIEISRLKKLVVLDISNIYNSLKIPNLRMLFHNLTELTELYLDDVDISAQGAQWCEAISSSLPNLRVLSMSGTNLSGPIDQSLAKIQSLSVIRLDFNYISGFFANYSKLSSLSLKYCQLQGSFPKEIFQVPTLQNIDLSHNLDLEGSLPEFPKNGSLRSLILRWTNFSGFLPNSIGNLKMLSTIDLSGCSFTGSIPKSMENLTELVSLYMPSQRLQGPVDFIHWENLVNLVHLQLEFNLLNGSIPSSIFSSPVLKELLLSHNQFSGQLHEFHNVSSNLITLDLSFNNLEGPIPVSILSFRGLYTLDLSSNNFTRFPFNGPQQLRNLSTIDLSHNSLLVLYNGSSSSSSSFPQIQDMNLASNKLRTFPNFLRNHIYLERLDLSENQIQGMVPNWIWGISSLSQLNLSSNSFSTLERPLPKNSSVSALDLHSNQLQGQIPFFSPSARYLDYSKNCFSSSIPTDIGDFLASTVFLSLSSNNLHGLIPVSICNAGYEVLDMSNNSLSGMVPQCLTEMKSLRVLILRKNNLNGTLSNRFTGYCGLRALDLGRNQIKGQLPKSLASCTNLEILNLGNNQIIDTFPCFLKSISTLRVLVLRSNRFYGGIGCSKTNGTWQMLQIVDLAHNNFNGEIPERSLTTWQAMTADEDGSRPKSNVLSSEGGQYTGAVYSFKDAITVTSKGSEMDLVKILTIFTLIDFSDNKFNGSIPEEMGVLKSLYILNLSSNAITGEIPSSLGNMRQLESLDLSQNKLSGHIPQQLTKLTFLAFLNLSNNQLGGMIPTSNQFSTFPPSSFTGNKGLSGPPLDNKTGLPPPPPTRNGSLPDSGSGHNEIDWDLISIEIGFTFGCAIAIGSLVFCKRWSKWY

HMMPfam: PF08263
IPR013210
40-88 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KNQQLSLLQLKKSLTFYNDSSGYSPLSSTKVISWNSSTDCCSWVGVTCS

Seg: seg
42-53 seg

QQLSLLQLKKSL

Gene3D: G3DSA:3.80.10.10
71-301 no description

ISWNSSTDCCSWVGVTCSTSGHVVGLDISSECITGGIDNSSSLFDLQHLQILNLANNKLGSVDHSIPSAIGKLTDLRYLNLSKTDYSGQIPIEISRLKKLVVLDISNIYNSLKIPNLRMLFHNLTELTELYLDDVDISAQGAQWCEAISSSLPNLRVLSMSGTNLSGPIDQSLAKIQSLSVIRLDFNYISGFFANYSKLSSLSLKYCQLQGSFPKEIFQVPTLQNIDLSHN

superfamily: SSF52047
95-425 RNI-like,LRR

GLDISSECITGGIDNSSSLFDLQHLQILNLANNKLGSVDHSIPSAIGKLTDLRYLNLSKTDYSGQIPIEISRLKKLVVLDISNIYNSLKIPNLRMLFHNLTELTELYLDDVDISAQGAQWCEAISSSLPNLRVLSMSGTNLSGPIDQSLAKIQSLSVIRLDFNYISGFFANYSKLSSLSLKYCQLQGSFPKEIFQVPTLQNIDLSHNLDLEGSLPEFPKNGSLRSLILRWTNFSGFLPNSIGNLKMLSTIDLSGCSFTGSIPKSMENLTELVSLYMPSQRLQGPVDFIHWENLVNLVHLQLEFNLLNGSIPSSIFSSPVLKELLLSHNQFS

HMMSmart: SM00369
IPR003591
116-139 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQHLQILNLANNKLGSVDHSIPSA

HMMPfam: PF12799
118-157 LRR_4,Leucine Rich repeats (2 copies)

HLQILNLANNKLGSVDHSIPSAIGKLTDLRYLNLSKTDYS

Seg: seg
267-275 seg

SKLSSLSLK

Gene3D: G3DSA:3.80.10.10
302-420 no description

LDLEGSLPEFPKNGSLRSLILRWTNFSGFLPNSIGNLKMLSTIDLSGCSFTGSIPKSMENLTELVSLYMPSQRLQGPVDFIHWENLVNLVHLQLEFNLLNGSIPSSIFSSPVLKELLLS

superfamily: SSF52047
337-615 RNI-like,LRR

NLKMLSTIDLSGCSFTGSIPKSMENLTELVSLYMPSQRLQGPVDFIHWENLVNLVHLQLEFNLLNGSIPSSIFSSPVLKELLLSHNQFSGQLHEFHNVSSNLITLDLSFNNLEGPIPVSILSFRGLYTLDLSSNNFTRFPFNGPQQLRNLSTIDLSHNSLLVLYNGSSSSSSSFPQIQDMNLASNKLRTFPNFLRNHIYLERLDLSENQIQGMVPNWIWGISSLSQLNLSSNSFSTLERPLPKNSSVSALDLHSNQLQGQIPFFSPSARYLDYSKNCFS

HMMPfam: PF00560
IPR001611
341-362 LRR_1
Leucine-rich repeat

LSTIDLSGCSFTGSIPKSMENL

HMMSmart: SM00369
IPR003591
387-411 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVNLVHLQLEFNLLNGSIPSSIFSS

Gene3D: G3DSA:3.80.10.10
421-657 no description

HNQFSGQLHEFHNVSSNLITLDLSFNNLEGPIPVSILSFRGLYTLDLSSNNFTRFPFNGPQQLRNLSTIDLSHNSLLVLYNGSSSSSSSFPQIQDMNLASNKLRTFPNFLRNHIYLERLDLSENQIQGMVPNWIWGISSLSQLNLSSNSFSTLERPLPKNSSVSALDLHSNQLQGQIPFFSPSARYLDYSKNCFSSSIPTDIGDFLASTVFLSLSSNNLHGLIPVSICNAGYEVLDM

HMMPfam: PF00560
IPR001611
437-457 LRR_1
Leucine-rich repeat

NLITLDLSFNNLEGPIPVSIL

HMMSmart: SM00369
IPR003591
459-482 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FRGLYTLDLSSNNFTRFPFNGPQQ

HMMSmart: SM00369
IPR003591
483-506 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLSTIDLSHNSLLVLYNGSSSS

Seg: seg
503-509 seg

SSSSSSS

HMMSmart: SM00369
IPR003591
510-533 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FPQIQDMNLASNKLRTFPNFLRNH

HMMPfam: PF13855
511-569 LRR_8,Leucine rich repeat

PQIQDMNLASNKLRTFPNFLRNHIYLERLDLSENQIQGMVPNWIWGISSLSQLNLSSNS

HMMSmart: SM00369
IPR003591
536-556 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LERLDLSENQIQGMVPNWIWG

FPrintScan: PR00019
536-549 LEURICHRPT,Leucine-rich repeat signature

LERLDLSENQIQGM

HMMSmart: SM00369
IPR003591
557-580 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

ISSLSQLNLSSNSFSTLERPLPKN

Seg: seg
558-573 seg

SSLSQLNLSSNSFSTL

superfamily: SSF52058
653-964 L domain-like,LRR

EVLDMSNNSLSGMVPQCLTEMKSLRVLILRKNNLNGTLSNRFTGYCGLRALDLGRNQIKGQLPKSLASCTNLEILNLGNNQIIDTFPCFLKSISTLRVLVLRSNRFYGGIGCSKTNGTWQMLQIVDLAHNNFNGEIPERSLTTWQAMTADEDGSRPKSNVLSSEGGQYTGAVYSFKDAITVTSKGSEMDLVKILTIFTLIDFSDNKFNGSIPEEMGVLKSLYILNLSSNAITGEIPSSLGNMRQLESLDLSQNKLSGHIPQQLTKLTFLAFLNLSNNQLGGMIPTSNQFSTFPPSSFTGNKGLSGPPLDNKT

HMMSmart: SM00369
IPR003591
673-696 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKSLRVLILRKNNLNGTLSNRFTG

HMMPfam: PF12799
700-736 LRR_4,Leucine Rich repeats (2 copies)

LRALDLGRNQIKGQLPKSLASCTNLEILNLGNNQIID

Gene3D: G3DSA:3.80.10.10
851-960 no description

LIDFSDNKFNGSIPEEMGVLKSLYILNLSSNAITGEIPSSLGNMRQLESLDLSQNKLSGHIPQQLTKLTFLAFLNLSNNQLGGMIPTSNQFSTFPPSSFTGNKGLSGPPL

HMMSmart: SM00369
IPR003591
870-893 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLYILNLSSNAITGEIPSSLGN

HMMPfam: PF13855
872-931 LRR_8,Leucine rich repeat

SLYILNLSSNAITGEIPSSLGNMRQLESLDLSQNKLSGHIPQQLTKLTFLAFLNLSNNQL

HMMSmart: SM00369
IPR003591
894-917 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MRQLESLDLSQNKLSGHIPQQLTK

FPrintScan: PR00019
894-907 LEURICHRPT,Leucine-rich repeat signature

MRQLESLDLSQNKL

HMMSmart: SM00369
IPR003591
918-951 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTFLAFLNLSNNQLGGMIPTSNQFSTFPPSSFTG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox