PRGDB00172625 (ppa015759m)

From PRG Wiki
Jump to: navigation, search
ppa015759m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

DNA Sequence

CTAGTGTCCTCCTCTGAAGCTCAAACAGAAACAGGAGGAGGAGGAGGAGGAGAAGGAGGAGGATCCCCTGTTTGCGCAGAAGCAGATAGAGCTTCCCTTGTGAGCTTCAAAGGCAGAATCATCAAGGACACAACAGGAATTCTTTCTTCATGGATAGGCAGAGACTGCTGTGGAGGAGGTTGGGAAGGTGTTGAGTGCAATCCAGCTGGGAGGCAAATCACGGGTCCAATTCCAGAGAGCTTCTCTAATCTCGCCCACCTCACCCAATTGGCCCTTGAAGACAATTCCCTCGTAGGGAACATTCCTCCAGGTTTAGGTCAGTTGTCCTCCCTCCAAAGCCTCTCCCTCAGCGGCAACCGTTTCAGGGGTCAGATTCCCCCAACCCTAGGCCATCTCACCAATCTCGTCCAAATCAATTTAAAAAGAAATTTCCTCACCGGTTCAATCCCTCCCACTTTTCAAAATTTTCATGCTTTGCAGTATCTTGATCTCAGCTTCAATATGTTGTCCGGCCTCATTCCAGATTTCATTGGTGGCCGCTACTTACCAAACCTCACTTTGATTGACCTCTCCAATAACCAGTTTTCTGGTCAGATGCCCATTTCCCTCTTCAGCTTGCCCAAGCTTTTGGACCTCTCCCTGAACCAAAACCAGCTGACCGGCATAATCCCAGTCCAGGTGGAGGGCCTCAAATCCCTTACCAGTCTTTCATTGAGCTCCAATCGCCTTACCGGCCACATTCCCATTTCCATTTCAAGGTTGCACAACCTCTGGTACCTAAATTTATCTGCCAATGGGCTTTCAGACCCTCTTCCCTCTACCCTTGCCACGGGCATTCCTTCTCTCTTGTCAATAGACTTGTCTTACAACAAGCTCAGTTTGGGGAAAGTTCCAGATTGGATCAGGAGCAGACAGCTTCGAGATGTTCATCTTGCCGGCTGCCAGTTAAGCGGAACCCTCCCAAGCTTTGCAAAGCCTGATTCTTTCAACTCCATTGACCTCTCTCATAATCATTTTACTGGTGGAATTTCAAACTTGTTGGCCAACATGTCAAGCCTGCAGAACCTCAACCTCTCCAACAACCAACTCAAGGCTGATCTTTCCGAAATCAAGTTGCCCGACACCCTCTCTTCCCTGGATTTTAGGGAAGGCTTGAGGCTGAAAATGCTCGACGTAGGAAGCAACAAGATCGCTGGTCCCATCCCCAACTCAGTTTCAAACCTGGCTCAACTGGAGAGGTTTGATATATCAAGAAACCAGATAACAGGCACCATCCCCACAAGTTTGGGGTTGCTGTTGAAGCTTCAATGGCTTGACGTGTCCATCAATGGGCTCACTGGAAAGATTCCAAACAGCCTACTGGGGATTGAACGTCTCAAGCACGCAAGCTTCAGGGCAAACAGGTTGTGTGGGGAGATCCCACAAGGGAGACCATTTAACATTTTTCCTGCAGCTGCATATCTGCACAATTTGTGCCTTTGTGGCAAGCCTATGCCACCTTGCAGGCAGAGCCAGTAA


Protein sequences

Name Description Sequence
ppa015759m Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

LVSSSEAQTETGGGGGGEGGGSPVCAEADRASLVSFKGRIIKDTTGILSSWIGRDCCGGGWEGVECNPAGRQITGPIPESFSNLAHLTQLALEDNSLVGNIPPGLGQLSSLQSLSLSGNRFRGQIPPTLGHLTNLVQINLKRNFLTGSIPPTFQNFHALQYLDLSFNMLSGLIPDFIGGRYLPNLTLIDLSNNQFSGQMPISLFSLPKLLDLSLNQNQLTGIIPVQVEGLKSLTSLSLSSNRLTGHIPISISRLHNLWYLNLSANGLSDPLPSTLATGIPSLLSIDLSYNKLSLGKVPDWIRSRQLRDVHLAGCQLSGTLPSFAKPDSFNSIDLSHNHFTGGISNLLANMSSLQNLNLSNNQLKADLSEIKLPDTLSSLDFREGLRLKMLDVGSNKIAGPIPNSVSNLAQLERFDISRNQITGTIPTSLGLLLKLQWLDVSINGLTGKIPNSLLGIERLKHASFRANRLCGEIPQGRPFNIFPAAAYLHNLCLCGKPMPPCRQSQ*


Domains

Domain Start-End Description Sequence

Seg: seg
9-21 seg

TETGGGGGGEGGG

Gene3D: G3DSA:3.80.10.10
25-286 no description

CAEADRASLVSFKGRIIKDTTGILSSWIGRDCCGGGWEGVECNPAGRQITGPIPESFSNLAHLTQLALEDNSLVGNIPPGLGQLSSLQSLSLSGNRFRGQIPPTLGHLTNLVQINLKRNFLTGSIPPTFQNFHALQYLDLSFNMLSGLIPDFIGGRYLPNLTLIDLSNNQFSGQMPISLFSLPKLLDLSLNQNQLTGIIPVQVEGLKSLTSLSLSSNRLTGHIPISISRLHNLWYLNLSANGLSDPLPSTLATGIPSLLSID

HMMPanther: PTHR24420
25-499 FAMILY NOT NAMED,FAMILY NOT NAMED

CAEADRASLVSFKGRIIKDTTGILSSWIGRDCCGGGWEGVECNPAGRQITGPIPESFSNLAHLTQLALEDNSLVGNIPPGLGQLSSLQSLSLSGNRFRGQIPPTLGHLTNLVQINLKRNFLTGSIPPTFQNFHALQYLDLSFNMLSGLIPDFIGGRYLPNLTLIDLSNNQFSGQMPISLFSLPKLLDLSLNQNQLTGIIPVQVEGLKSLTSLSLSSNRLTGHIPISISRLHNLWYLNLSANGLSDPLPSTLATGIPSLLSIDLSYNKLSLGKVPDWIRSRQLRDVHLAGCQLSGTLPSFAKPDSFNSIDLSHNHFTGGISNLLANMSSLQNLNLSNNQLKADLSEIKLPDTLSSLDFREGLRLKMLDVGSNKIAGPIPNSVSNLAQLERFDISRNQITGTIPTSLGLLLKLQWLDVSINGLTGKIPNSLLGIERLKHASFRANRLCGEIPQGRPFNIFPAAAYLHNLCLCGKPMP

HMMPanther: PTHR24420:SF506
25-499 DISEASE RESISTANCE FAMILY PROTEIN / LRR FAMILY PROTEIN

CAEADRASLVSFKGRIIKDTTGILSSWIGRDCCGGGWEGVECNPAGRQITGPIPESFSNLAHLTQLALEDNSLVGNIPPGLGQLSSLQSLSLSGNRFRGQIPPTLGHLTNLVQINLKRNFLTGSIPPTFQNFHALQYLDLSFNMLSGLIPDFIGGRYLPNLTLIDLSNNQFSGQMPISLFSLPKLLDLSLNQNQLTGIIPVQVEGLKSLTSLSLSSNRLTGHIPISISRLHNLWYLNLSANGLSDPLPSTLATGIPSLLSIDLSYNKLSLGKVPDWIRSRQLRDVHLAGCQLSGTLPSFAKPDSFNSIDLSHNHFTGGISNLLANMSSLQNLNLSNNQLKADLSEIKLPDTLSSLDFREGLRLKMLDVGSNKIAGPIPNSVSNLAQLERFDISRNQITGTIPTSLGLLLKLQWLDVSINGLTGKIPNSLLGIERLKHASFRANRLCGEIPQGRPFNIFPAAAYLHNLCLCGKPMP

HMMPfam: PF08263
IPR013210
27-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EADRASLVSFKGRIIKDTTGILSSWIGRDCCGGGWEGVECN

superfamily: SSF52058
40-383 L domain-like,LRR

IIKDTTGILSSWIGRDCCGGGWEGVECNPAGRQITGPIPESFSNLAHLTQLALEDNSLVGNIPPGLGQLSSLQSLSLSGNRFRGQIPPTLGHLTNLVQINLKRNFLTGSIPPTFQNFHALQYLDLSFNMLSGLIPDFIGGRYLPNLTLIDLSNNQFSGQMPISLFSLPKLLDLSLNQNQLTGIIPVQVEGLKSLTSLSLSSNRLTGHIPISISRLHNLWYLNLSANGLSDPLPSTLATGIPSLLSIDLSYNKLSLGKVPDWIRSRQLRDVHLAGCQLSGTLPSFAKPDSFNSIDLSHNHFTGGISNLLANMSSLQNLNLSNNQLKADLSEIKLPDTLSSLDFRE

HMMSmart: SM00369
IPR003591
84-107 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LAHLTQLALEDNSLVGNIPPGLGQ

ProfileScan: PS51450
IPR001611
86-108 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTQLALEDNSLVGNIPPGLGQL

Seg: seg
104-118 seg

GLGQLSSLQSLSLSG

HMMSmart: SM00369
IPR003591
108-132 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLQSLSLSGNRFRGQIPPTLGHL

HMMPfam: PF13855
109-169 LRR_8,Leucine rich repeat

SSLQSLSLSGNRFRGQIPPTLGHLTNLVQINLKRNFLTGSIPPTFQNFHALQYLDLSFNML

ProfileScan: PS51450
IPR001611
110-133 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQSLSLSGNRFRGQIPPTLGHLT

HMMSmart: SM00369
IPR003591
156-179 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FHALQYLDLSFNMLSGLIPDFIGG

ProfileScan: PS51450
IPR001611
158-180 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQYLDLSFNMLSGLIPDFIGGR

FPrintScan: PR00019
159-172 LEURICHRPT,Leucine-rich repeat signature

LQYLDLSFNMLSGL

HMMSmart: SM00369
IPR003591
182-206 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLTLIDLSNNQFSGQMPISLFSL

HMMPfam: PF13855
183-243 LRR_8,Leucine rich repeat

PNLTLIDLSNNQFSGQMPISLFSLPKLLDLSLNQNQLTGIIPVQVEGLKSLTSLSLSSNRL

ProfileScan: PS51450
IPR001611
184-205 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTLIDLSNNQFSGQMPISLFS

Seg: seg
202-214 seg

SLFSLPKLLDLSL

ProfileScan: PS51450
IPR001611
208-229 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLLDLSLNQNQLTGIIPVQVEG

HMMSmart: SM00369
IPR003591
230-254 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLTSLSLSSNRLTGHIPISISRL

Seg: seg
230-243 seg

LKSLTSLSLSSNRL

ProfileScan: PS51450
IPR001611
232-254 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTSLSLSSNRLTGHIPISISRL

HMMPfam: PF13516
254-276 LRR_6,Leucine Rich repeat

LHNLWYLNLSANGLSDPLPSTLA

ProfileScan: PS51450
IPR001611
256-277 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLWYLNLSANGLSDPLPSTLAT

ProfileScan: PS51450
IPR001611
281-301 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLSIDLSYNKLSLGKVPDWI

Gene3D: G3DSA:3.80.10.10
287-499 no description

LSYNKLSLGKVPDWIRSRQLRDVHLAGCQLSGTLPSFAKPDSFNSIDLSHNHFTGGISNLLANMSSLQNLNLSNNQLKADLSEIKLPDTLSSLDFREGLRLKMLDVGSNKIAGPIPNSVSNLAQLERFDISRNQITGTIPTSLGLLLKLQWLDVSINGLTGKIPNSLLGIERLKHASFRANRLCGEIPQGRPFNIFPAAAYLHNLCLCGKPMP

HMMPfam: PF13855
305-363 LRR_8,Leucine rich repeat

QLRDVHLAGCQLSGTLPSFAKPDSFNSIDLSHNHFTGGISNLLANMSSLQNLNLSNNQL

ProfileScan: PS51450
IPR001611
328-350 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SFNSIDLSHNHFTGGISNLLANM

Seg: seg
344-363 seg

SNLLANMSSLQNLNLSNNQL

FPrintScan: PR00019
350-363 LEURICHRPT,Leucine-rich repeat signature

MSSLQNLNLSNNQL

HMMSmart: SM00369
IPR003591
350-379 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MSSLQNLNLSNNQLKADLSEIKLPDTLSSL

ProfileScan: PS51450
IPR001611
352-373 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQNLNLSNNQLKADLSEIKLP

superfamily: SSF52058
384-502 L domain-like,LRR

GLRLKMLDVGSNKIAGPIPNSVSNLAQLERFDISRNQITGTIPTSLGLLLKLQWLDVSINGLTGKIPNSLLGIERLKHASFRANRLCGEIPQGRPFNIFPAAAYLHNLCLCGKPMPPCR

ProfileScan: PS51450
IPR001611
386-408 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLKMLDVGSNKIAGPIPNSVSNL

HMMSmart: SM00369
IPR003591
408-432 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LAQLERFDISRNQITGTIPTSLGLL

HMMPfam: PF00560
IPR001611
410-430 LRR_1
Leucine-rich repeat

QLERFDISRNQITGTIPTSLG

ProfileScan: PS51450
IPR001611
410-432 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLERFDISRNQITGTIPTSLGLL

ProfileScan: PS51450
IPR001611
434-455 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQWLDVSINGLTGKIPNSLLG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox