PRGDB00172807 (ppa001461m)

From PRG Wiki
Jump to: navigation, search
ppa001461m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RPW8-NL
Domain Type NBS, LRR, RPW8, Others
Gene Species Prunus persica

Comment?

ADR1-like 1 (best arabidopsis hit)

DNA Sequence

ATGGCAGTGACAGATTTCTTCGCCGGAGAGATCGCGACCGAGCTTCTGAAGACCCTCTTATCCATCTCCAGAAAGTCATGTCTCAGCAAAGGAACTGCAGAGAGCCTCATAGCCTCCATCAATGTCCTCCTCCCCATAATTCAAGAGATCAAATTCTCTGGCGTGGAGCTACCAGCCGCACGCCAGTTCCAGCTCGACCGCTTCTCCGAAGTTCTGAAACAGGGCCTCGAGCTGGCCAACAAGGTCCTCGCCTCCCCACGCTGGAACGTCTACAAGAACCTCCTCTTGGCCCGGAAGATGGAGAAGCTTGAGAATACGGTGTCCAAATTCATGCAGGGCCCATTGCAGGCCCATATATTGGCTGACGTGCACCAAATGAGGATTGAAACTGCTCAGCGGTTCGACCGGTTTGAAGGGAACCAGCGGCTGGAGCAACGGCTTGGGGCTTTAAAAATTGGAACTTGTAGTGGTGGTGGCGGCGGCGGTGGGTGGATGGAAGAGTCTGTGAGGAGGGTGGAGGAGGAGGGGAAGATGAAGTGGGAGATCAGCAATTCATTGGTTTTGGGATTGGGTTTGGGGATGAAGAAGGTGAAGGAGATGATTTTTGGGAGAGAGGATTTGAGGGTTGTTGGGATTTGTGGGATTGGAGGCTCTGGAAAAACCACTCTTGCTAGAGAGCTTTGCAAGGATGATCAAGTTAGATCTTACTTCCAGGAAAGAATTTTGTTCCTGACGGTGTCACAGTCTCCAAATGTGGAGCATCTGAAAGCGAAGATTGTGGGATTTATTATGGGGAACCAAATGTTGAGTCCTACTTCTGTGCTTCCTCAATGGAATCTGCAATATGAGTGGCTCAACGTAACAAAAACTCTGGTGGTTTTGGATGATGTGTGGTCACTCGCAGAGCTTGAGCCACTGCTCTTTAAAATTCCCGGTTGCAAGATACTTGTAGTCTCACGTTTCAAATTCCCAAAAGTTATAGATGCCACTTATGACGTGGAGTTGTTAAAGGAAGATGAAGCCCTCTCTCTGTTTTGCCACTCTGCTTTTGGCCAAAAGTCAGTTCCTCCTGCTGCTGATAAAAATTTGGTGAAGCAGATTGTTAACGAGTGTAAGCGACTTCCTCTGGCTCTTAAAGTGATTGGAGCTTCATTAAGGGACCAGCCTGAATGGTATTGGGCAAATGCAAGGAGCAGGTTGTCACGAGGAGAAGCTATTTGTGAGTCCCATGAGAACAATCTACTTCAACGGATGGCAATAAGTGTGAACTGCTTACCCCGAAAAGTTAAGGAATGTTTCTTGGACTTGGGTGCCTTTCCAGAAGACAAGAAGATCCCTCTTGATCTGCTTACCAACATGTGGGTTGAAACACACGGTATTGATGAAGAAGGAGCCTTGGCTATTCTTGCCGAGCTTTCAGATAAGAATCTCCTTACCCTGGTGAAAGATGCAAGAGATGGAGATATATATAGCAGTTGCTATGACATCTCTGTTACACAGCATGATGTGCTGAGGGACCTTGCTCTTCATTTGAGCGATGATGACTGCGTAAATAATCGCAGTCGATTACTTATGGCAAGAAGAGAGGAAGAACTTCCAAGAGAATGGGACAGGTATTCAGATCAGCCATTTAATGCCAGGATTGTATCAATTCATACAGGTGAAATGAAAGAGATGGACTGGTTCCAGATGGAGTTCCCTAAATGTGAAGTGCTCATTTTGAATTTTGCCTCCAACGAGTACCTTTTACCTCCCTTCATTGCCAACATGCCAAAGCTGAGGGCATTGATAATAATGAATTACAGTACATCAAATGCAACCCTCCATGGGTTTTCAGTGTTGTCAATTCTGCCCAAGTTGAGAACCCTCTGGCTTGAAAAAGTTTCCGTCCCTCAATTATCCACCACCCCCCTGAAAAATTTGAGGAAATTTTCAATAATCCTATGCAAGATTAGTAACAGCCTTGATCAATCAGCCTTTCCTCTGCTATTGGAAGTCACAATCGATCATTGTGACGATTTATTCATGCTGCCTTCATGCATTTGTGAAATGCATTTGCTCAAGAACCTGAGCATAACCAACTGCCACAGCCTATACCAGCTGCCAACTGATCTGGATAAGCTGAAATCTCTGCAAATCCTAAGGTTATATGCATGTCCGGCACTGCAGACGCTTCCTGCTGGCATTTGTGAGCTACTTTGTTTGAAATACCTAGACATTTCCCAATGTGTTAATTTGAGGTGCCTTCCCATAGGCATTGGTAAGTTAGCAAATTTGGAAAAGATTGACATGAGGGAGTGTTCACAGATCAGGAACCTACCAAAATCTGCTACAACATTACATTCTCTGCGTCGTGTAGTATGCGATGAAGAGATGTCTGGGCTGTGGAGAGATGCAGAGAAGGCATTGCCGGACCTTCTTGTTCAGGCAGCAGAGAAACATTTCGATCTGGACTGGCTTGACGAGTGA


Protein sequences

Name Description Sequence
ppa001461m ADR1-like 1 (best arabidopsis hit)

MAVTDFFAGEIATELLKTLLSISRKSCLSKGTAESLIASINVLLPIIQEIKFSGVELPAARQFQLDRFSEVLKQGLELANKVLASPRWNVYKNLLLARKMEKLENTVSKFMQGPLQAHILADVHQMRIETAQRFDRFEGNQRLEQRLGALKIGTCSGGGGGGGWMEESVRRVEEEGKMKWEISNSLVLGLGLGMKKVKEMIFGREDLRVVGICGIGGSGKTTLARELCKDDQVRSYFQERILFLTVSQSPNVEHLKAKIVGFIMGNQMLSPTSVLPQWNLQYEWLNVTKTLVVLDDVWSLAELEPLLFKIPGCKILVVSRFKFPKVIDATYDVELLKEDEALSLFCHSAFGQKSVPPAADKNLVKQIVNECKRLPLALKVIGASLRDQPEWYWANARSRLSRGEAICESHENNLLQRMAISVNCLPRKVKECFLDLGAFPEDKKIPLDLLTNMWVETHGIDEEGALAILAELSDKNLLTLVKDARDGDIYSSCYDISVTQHDVLRDLALHLSDDDCVNNRSRLLMARREEELPREWDRYSDQPFNARIVSIHTGEMKEMDWFQMEFPKCEVLILNFASNEYLLPPFIANMPKLRALIIMNYSTSNATLHGFSVLSILPKLRTLWLEKVSVPQLSTTPLKNLRKFSIILCKISNSLDQSAFPLLLEVTIDHCDDLFMLPSCICEMHLLKNLSITNCHSLYQLPTDLDKLKSLQILRLYACPALQTLPAGICELLCLKYLDISQCVNLRCLPIGIGKLANLEKIDMRECSQIRNLPKSATTLHSLRRVVCDEEMSGLWRDAEKALPDLLVQAAEKHFDLDWLDE*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-149 RPW8
Powdery mildew resistance protein, RPW8 domain

MAVTDFFAGEIATELLKTLLSISRKSCLSKGTAESLIASINVLLPIIQEIKFSGVELPAARQFQLDRFSEVLKQGLELANKVLASPRWNVYKNLLLARKMEKLENTVSKFMQGPLQAHILADVHQMRIETAQRFDRFEGNQRLEQRLGA

HMMPfam: PF05659
IPR008808
13-128 RPW8
Powdery mildew resistance protein, RPW8 domain

TELLKTLLSISRKSCLSKGTAESLIASINVLLPIIQEIKFSGVELPAARQFQLDRFSEVLKQGLELANKVLASPRWNVYKNLLLARKMEKLENTVSKFMQGPLQAHILADVHQMRI

HMMPanther: PTHR23155:SF282
28-792 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LSKGTAESLIASINVLLPIIQEIKFSGVELPAARQFQLDRFSEVLKQGLELANKVLASPRWNVYKNLLLARKMEKLENTVSKFMQGPLQAHILADVHQMRIETAQRFDRFEGNQRLEQRLGALKIGTCSGGGGGGGWMEESVRRVEEEGKMKWEISNSLVLGLGLGMKKVKEMIFGREDLRVVGICGIGGSGKTTLARELCKDDQVRSYFQERILFLTVSQSPNVEHLKAKIVGFIMGNQMLSPTSVLPQWNLQYEWLNVTKTLVVLDDVWSLAELEPLLFKIPGCKILVVSRFKFPKVIDATYDVELLKEDEALSLFCHSAFGQKSVPPAADKNLVKQIVNECKRLPLALKVIGASLRDQPEWYWANARSRLSRGEAICESHENNLLQRMAISVNCLPRKVKECFLDLGAFPEDKKIPLDLLTNMWVETHGIDEEGALAILAELSDKNLLTLVKDARDGDIYSSCYDISVTQHDVLRDLALHLSDDDCVNNRSRLLMARREEELPREWDRYSDQPFNARIVSIHTGEMKEMDWFQMEFPKCEVLILNFASNEYLLPPFIANMPKLRALIIMNYSTSNATLHGFSVLSILPKLRTLWLEKVSVPQLSTTPLKNLRKFSIILCKISNSLDQSAFPLLLEVTIDHCDDLFMLPSCICEMHLLKNLSITNCHSLYQLPTDLDKLKSLQILRLYACPALQTLPAGICELLCLKYLDISQCVNLRCLPIGIGKLANLEKIDMRECSQIRNLPKSATTLHSLRRVVCDEEM

HMMPanther: PTHR23155
28-792 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSKGTAESLIASINVLLPIIQEIKFSGVELPAARQFQLDRFSEVLKQGLELANKVLASPRWNVYKNLLLARKMEKLENTVSKFMQGPLQAHILADVHQMRIETAQRFDRFEGNQRLEQRLGALKIGTCSGGGGGGGWMEESVRRVEEEGKMKWEISNSLVLGLGLGMKKVKEMIFGREDLRVVGICGIGGSGKTTLARELCKDDQVRSYFQERILFLTVSQSPNVEHLKAKIVGFIMGNQMLSPTSVLPQWNLQYEWLNVTKTLVVLDDVWSLAELEPLLFKIPGCKILVVSRFKFPKVIDATYDVELLKEDEALSLFCHSAFGQKSVPPAADKNLVKQIVNECKRLPLALKVIGASLRDQPEWYWANARSRLSRGEAICESHENNLLQRMAISVNCLPRKVKECFLDLGAFPEDKKIPLDLLTNMWVETHGIDEEGALAILAELSDKNLLTLVKDARDGDIYSSCYDISVTQHDVLRDLALHLSDDDCVNNRSRLLMARREEELPREWDRYSDQPFNARIVSIHTGEMKEMDWFQMEFPKCEVLILNFASNEYLLPPFIANMPKLRALIIMNYSTSNATLHGFSVLSILPKLRTLWLEKVSVPQLSTTPLKNLRKFSIILCKISNSLDQSAFPLLLEVTIDHCDDLFMLPSCICEMHLLKNLSITNCHSLYQLPTDLDKLKSLQILRLYACPALQTLPAGICELLCLKYLDISQCVNLRCLPIGIGKLANLEKIDMRECSQIRNLPKSATTLHSLRRVVCDEEM

Seg: seg
157-163 seg

GGGGGGG

Seg: seg
186-198 seg

LVLGLGLGMKKVK

Gene3D: G3DSA:3.40.50.300
195-228 no description

KKVKEMIFGREDLRVVGICGIGGSGKTTLARELC

HMMPfam: PF00931
IPR002182
195-457 NB-ARC,NBS
NB-ARC

KKVKEMIFGREDLRVVGICGIGGSGKTTLARELCKDDQVRSYFQERILFLTVSQSPNVEHLKAKIVGFIMGNQMLSPTSVLPQWNLQYEWLNVTKTLVVLDDVWSLAELEPLLFKIPGCKILVVSRFKFPKVIDATYDVELLKEDEALSLFCHSAFGQKSVPPAADKNLVKQIVNECKRLPLALKVIGASLRDQPEWYWANARSRLSRGEAICESHENNLLQRMAISVNCLPRKVKECFLDLGAFPEDKKIPLDLLTNMWVET

superfamily: SSF52540
205-418 P-loop containing nucleoside triphosphate hydrolases

EDLRVVGICGIGGSGKTTLARELCKDDQVRSYFQERILFLTVSQSPNVEHLKAKIVGFIMGNQMLSPTSVLPQWNLQYEWLNVTKTLVVLDDVWSLAELEPLLFKIPGCKILVVSRFKFPKVIDATYDVELLKEDEALSLFCHSAFGQKSVPPAADKNLVKQIVNECKRLPLALKVIGASLRDQPEWYWANARSRLSRGEAICESHENNLLQRM

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

VVGICGIGGSGKTTLA

FPrintScan: PR00364
IPR000767
284-298 DISEASERSIST
Disease resistance protein

WLNVTKTLVVLDDVW

FPrintScan: PR00364
IPR000767
371-385 DISEASERSIST
Disease resistance protein

CKRLPLALKVIGASL

superfamily: SSF52047
558-786 RNI-like,LRR

EMDWFQMEFPKCEVLILNFASNEYLLPPFIANMPKLRALIIMNYSTSNATLHGFSVLSILPKLRTLWLEKVSVPQLSTTPLKNLRKFSIILCKISNSLDQSAFPLLLEVTIDHCDDLFMLPSCICEMHLLKNLSITNCHSLYQLPTDLDKLKSLQILRLYACPALQTLPAGICELLCLKYLDISQCVNLRCLPIGIGKLANLEKIDMRECSQIRNLPKSATTLHSLRRV

Gene3D: G3DSA:3.80.10.10
570-786 no description

EVLILNFASNEYLLPPFIANMPKLRALIIMNYSTSNATLHGFSVLSILPKLRTLWLEKVSVPQLSTTPLKNLRKFSIILCKISNSLDQSAFPLLLEVTIDHCDDLFMLPSCICEMHLLKNLSITNCHSLYQLPTDLDKLKSLQILRLYACPALQTLPAGICELLCLKYLDISQCVNLRCLPIGIGKLANLEKIDMRECSQIRNLPKSATTLHSLRRV

FPrintScan: PR00364
IPR000767
754-770 DISEASERSIST
Disease resistance protein

GKLANLEKIDMRECSQI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox