PRGDB00172910 (ppa001610m)

From PRG Wiki
Jump to: navigation, search
ppa001610m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Prunus persica

Comment?

Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGGGAGGACCAGATTTTGGAGGGGCTGGTCTAGGAGCACTGTTTAATGTGTTGTATGATGGCCTCAAGGAGCTGATCGGCAAGAATGTCATATATAAAACCCTCCTCAAAGCCATCATATCGAGGTTAGACATTTTACACCCATTGATCAAAGAAATAGCAAAATACAACAAGGATTTGGATCTCCCAGATAAGGAACTAGAAAATCTGAAAGTAGGGATGGAGAAGGGCATAGAGCTGGTCCACAAGTGCTCAAAGATTCGTGCTTGGAACATCTATAAAAAGTACAAATATGCCAACAAACTTCTTGATTGGAACGAATCTCTTCTAGGGCTTTTAGATATGCTGAATGTGCAGGGCATAAGGGATGTGAAGGGGAGCTCGGTTTCGGTGAGGAACATAGAGAAGGTGGTCAGCCGAATTGAATCAACACCTGAACTTCCGGCGCTTGTAGTTGGGTTGGATTTTCCTTTGAAGGAGTTGAAGAGGAAGCTTCTTAATTTTAAAGATGGGGTGTCGATGCTTGTTCTGACCGCTCCTGGAGGATGTGGCAAGACCACTTTGGCAACAGCATTTTGTCAAGATCAGGAAGTCAAAGATACATTTGGGGACAATATCTTCTTTGTCACTGTTTCAAGCAACCCCAACTTGGAACGTATTGTTCAAGAACTTCATCTACGCAGGGGTTCTAAAGTACCTACTCTCGGAAACGAAATAAATGCAGTTAAGTGGCTGCACCATTTTCTCAAGGAAGAAGGACAAAATCCTTTACTGTTGGTCCTGGATGATGTTTGGTCTGGATCAGAATCCCTTCTGGAGAAGTTTGATCAATTTAAAATGCCAAACTACAAGCTTTTGGTGACATCAAGGTCTGAGTTTCGGGGATTTGGCTCTCCATATTCTTTACAGTCATTGGATTATCACAATGCAATGAAACTTTTTCATCATTCAGCATCCTTGGGAGATAAGAGCTCTCTTATTCCCCAAGATCTTTCAAGACAGATGGTAGAGCGTTGTAAGGGATTTCCACTTGCCATTAAAGTGCTTGGGAGATCACTTTGCGGGCAGCCTATAGAGATCTGGAAAAAGAGAGTAATTGAATGGACTAGAGGTTCTACTGTTCATGATTCAGAGGCTGAATTGCTTCTTTGTCTCCAAAGCAGCTTAGAAGCATTGGATAAAGAAATGGCTATCATAAAGGAATGTTTCTTAGACCTGGGTTCATTTCCTGAAGACCAAAGAATCCCTGCTGCTGCCCTCATTGATATATGGGAAGAGTTATATGATCTAGATGAAGACACAGATAACTTAGTTTTGATCATCACTAGGAAGGAAAATATGGAGGGGGATGAGTACTACAATGAACACTTTGTTACCCAACATGATATTCTTAGAGAGCTAGCCATCTACTACTCAAAACTAGAACCAGCAGAACAGAGAACAAGACTGATTATAGACATGCGAGGAAACAAACTTCCCAAGTGGTGGAGAGAACAGAAGCATCCATTGATGAAGGCTCGCCTGTTATCTATCTCAACCGACGGTGTATTTTCAGGAAAATGGCACAACATGCAAGTACCAGAAGTTGAGGTTCTAGTCTTGAATTTCCAGACAGAGAACTATGCCTTACCCGAATCTGTGGAGAACATGGATAAATTGAAGGCTTTAATAGTCACAAATTATGGTTTCTTACCAGCTGAGTTAAGTAACTTTCAACTTCTGAGCTCGTTATCAAATTTGAAGAGAATCAGATTAGAACGCATCTCAATTCTTTCCATAACCAAGAACCCCATAGAATTGAAGAGTCTGCAGAAGATATCCTTGTTCATGTGCAATATCGGTCAAGCTTTCAGCAACTGCTCCATCCCAATCTCATCAGCATTCCCGAATATAGAGGAAATGAACATTGACTATTGCCATGATTTGGTGGAATTGCCTGCCGAGCTCTGTGGTCTTAGTCAACTAAAGAAGCTCAGTGTCACCAATTGTCATAAGCTATCTGCCTTGCCTGAAGAGATTGGAAAGTTGACCAAGTTAGAAGTGTTGAGGCTAAAATCCTGTACAGACCTAGTAAAACTTCCAGGCTCGATGAAGAGCCTCAAAAAGTTAGACTTTCTTGACATATCTGATTGCTTCAGCATTAGGGAGTTGCCTGAAGACATTGGTGACATAAGCAATTTAAGAAAGATCAACATGAGACAGTGCTTAAGGTTGGAAGAGCTACCTCTATCTGTTTTGGATCTTGAGCAGTTAAAGGAAGTGATCTGTGATGAAGAGACAAAATATTTATGGGAATCTTTCTCATCTCACCTGAACAACGTAAGCATAAATGTGGCCAAAGAAAATATCAATCTTAATTGGCTCCACCACACTCAAATCTGA


Protein sequences

Name Description Sequence
ppa001610m Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit)

MGGPDFGGAGLGALFNVLYDGLKELIGKNVIYKTLLKAIISRLDILHPLIKEIAKYNKDLDLPDKELENLKVGMEKGIELVHKCSKIRAWNIYKKYKYANKLLDWNESLLGLLDMLNVQGIRDVKGSSVSVRNIEKVVSRIESTPELPALVVGLDFPLKELKRKLLNFKDGVSMLVLTAPGGCGKTTLATAFCQDQEVKDTFGDNIFFVTVSSNPNLERIVQELHLRRGSKVPTLGNEINAVKWLHHFLKEEGQNPLLLVLDDVWSGSESLLEKFDQFKMPNYKLLVTSRSEFRGFGSPYSLQSLDYHNAMKLFHHSASLGDKSSLIPQDLSRQMVERCKGFPLAIKVLGRSLCGQPIEIWKKRVIEWTRGSTVHDSEAELLLCLQSSLEALDKEMAIIKECFLDLGSFPEDQRIPAAALIDIWEELYDLDEDTDNLVLIITRKENMEGDEYYNEHFVTQHDILRELAIYYSKLEPAEQRTRLIIDMRGNKLPKWWREQKHPLMKARLLSISTDGVFSGKWHNMQVPEVEVLVLNFQTENYALPESVENMDKLKALIVTNYGFLPAELSNFQLLSSLSNLKRIRLERISILSITKNPIELKSLQKISLFMCNIGQAFSNCSIPISSAFPNIEEMNIDYCHDLVELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQLKEVICDEETKYLWESFSSHLNNVSINVAKENINLNWLHHTQI*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-151 RPW8
Powdery mildew resistance protein, RPW8 domain

MGGPDFGGAGLGALFNVLYDGLKELIGKNVIYKTLLKAIISRLDILHPLIKEIAKYNKDLDLPDKELENLKVGMEKGIELVHKCSKIRAWNIYKKYKYANKLLDWNESLLGLLDMLNVQGIRDVKGSSVSVRNIEKVVSRIESTPELPALV

Seg: seg
2-15 seg

GGPDFGGAGLGALF

HMMPanther: PTHR23155:SF239
4-751 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

PDFGGAGLGALFNVLYDGLKELIGKNVIYKTLLKAIISRLDILHPLIKEIAKYNKDLDLPDKELENLKVGMEKGIELVHKCSKIRAWNIYKKYKYANKLLDWNESLLGLLDMLNVQGIRDVKGSSVSVRNIEKVVSRIESTPELPALVVGLDFPLKELKRKLLNFKDGVSMLVLTAPGGCGKTTLATAFCQDQEVKDTFGDNIFFVTVSSNPNLERIVQELHLRRGSKVPTLGNEINAVKWLHHFLKEEGQNPLLLVLDDVWSGSESLLEKFDQFKMPNYKLLVTSRSEFRGFGSPYSLQSLDYHNAMKLFHHSASLGDKSSLIPQDLSRQMVERCKGFPLAIKVLGRSLCGQPIEIWKKRVIEWTRGSTVHDSEAELLLCLQSSLEALDKEMAIIKECFLDLGSFPEDQRIPAAALIDIWEELYDLDEDTDNLVLIITRKENMEGDEYYNEHFVTQHDILRELAIYYSKLEPAEQRTRLIIDMRGNKLPKWWREQKHPLMKARLLSISTDGVFSGKWHNMQVPEVEVLVLNFQTENYALPESVENMDKLKALIVTNYGFLPAELSNFQLLSSLSNLKRIRLERISILSITKNPIELKSLQKISLFMCNIGQAFSNCSIPISSAFPNIEEMNIDYCHDLVELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQL

HMMPanther: PTHR23155
4-751 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PDFGGAGLGALFNVLYDGLKELIGKNVIYKTLLKAIISRLDILHPLIKEIAKYNKDLDLPDKELENLKVGMEKGIELVHKCSKIRAWNIYKKYKYANKLLDWNESLLGLLDMLNVQGIRDVKGSSVSVRNIEKVVSRIESTPELPALVVGLDFPLKELKRKLLNFKDGVSMLVLTAPGGCGKTTLATAFCQDQEVKDTFGDNIFFVTVSSNPNLERIVQELHLRRGSKVPTLGNEINAVKWLHHFLKEEGQNPLLLVLDDVWSGSESLLEKFDQFKMPNYKLLVTSRSEFRGFGSPYSLQSLDYHNAMKLFHHSASLGDKSSLIPQDLSRQMVERCKGFPLAIKVLGRSLCGQPIEIWKKRVIEWTRGSTVHDSEAELLLCLQSSLEALDKEMAIIKECFLDLGSFPEDQRIPAAALIDIWEELYDLDEDTDNLVLIITRKENMEGDEYYNEHFVTQHDILRELAIYYSKLEPAEQRTRLIIDMRGNKLPKWWREQKHPLMKARLLSISTDGVFSGKWHNMQVPEVEVLVLNFQTENYALPESVENMDKLKALIVTNYGFLPAELSNFQLLSSLSNLKRIRLERISILSITKNPIELKSLQKISLFMCNIGQAFSNCSIPISSAFPNIEEMNIDYCHDLVELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQL

HMMPfam: PF05659
IPR008808
7-143 RPW8
Powdery mildew resistance protein, RPW8 domain

GGAGLGALFNVLYDGLKELIGKNVIYKTLLKAIISRLDILHPLIKEIAKYNKDLDLPDKELENLKVGMEKGIELVHKCSKIRAWNIYKKYKYANKLLDWNESLLGLLDMLNVQGIRDVKGSSVSVRNIEKVVSRIES

superfamily: SSF52540
134-370 P-loop containing nucleoside triphosphate hydrolases

IEKVVSRIESTPELPALVVGLDFPLKELKRKLLNFKDGVSMLVLTAPGGCGKTTLATAFCQDQEVKDTFGDNIFFVTVSSNPNLERIVQELHLRRGSKVPTLGNEINAVKWLHHFLKEEGQNPLLLVLDDVWSGSESLLEKFDQFKMPNYKLLVTSRSEFRGFGSPYSLQSLDYHNAMKLFHHSASLGDKSSLIPQDLSRQMVERCKGFPLAIKVLGRSLCGQPIEIWKKRVIEWTR

HMMPfam: PF00931
IPR002182
158-425 NB-ARC,NBS
NB-ARC

LKELKRKLLNFKDGVSMLVLTAPGGCGKTTLATAFCQDQEVKDTFGDNIFFVTVSSNPNLERIVQELHLRRGSKVPTLGNEINAVKWLHHFLKEEGQNPLLLVLDDVWSGSESLLEKFDQFKMPNYKLLVTSRSEFRGFGSPYSLQSLDYHNAMKLFHHSASLGDKSSLIPQDLSRQMVERCKGFPLAIKVLGRSLCGQPIEIWKKRVIEWTRGSTVHDSEAELLLCLQSSLEALDKEMAIIKECFLDLGSFPEDQRIPAAALIDIWE

Gene3D: G3DSA:3.40.50.300
164-278 no description

KLLNFKDGVSMLVLTAPGGCGKTTLATAFCQDQEVKDTFGDNIFFVTVSSNPNLERIVQELHLRRGSKVPTLGNEINAVKWLHHFLKEEGQNPLLLVLDDVWSGSESLLEKFDQF

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

MLVLTAPGGCGKTTLA

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

EEGQNPLLLVLDDVW

FPrintScan: PR00364
IPR000767
339-353 DISEASERSIST
Disease resistance protein

CKGFPLAIKVLGRSL

Seg: seg
377-392 seg

SEAELLLCLQSSLEAL

Gene3D: G3DSA:3.80.10.10
529-753 no description

VEVLVLNFQTENYALPESVENMDKLKALIVTNYGFLPAELSNFQLLSSLSNLKRIRLERISILSITKNPIELKSLQKISLFMCNIGQAFSNCSIPISSAFPNIEEMNIDYCHDLVELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQLKE

superfamily: SSF52047
542-754 RNI-like,LRR

ALPESVENMDKLKALIVTNYGFLPAELSNFQLLSSLSNLKRIRLERISILSITKNPIELKSLQKISLFMCNIGQAFSNCSIPISSAFPNIEEMNIDYCHDLVELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQLKEV

Seg: seg
568-580 seg

LSNFQLLSSLSNL

Seg: seg
582-593 seg

RIRLERISILSI

FPrintScan: PR00364
IPR000767
698-714 DISEASERSIST
Disease resistance protein

KSLKKLDFLDISDCFSI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox