PRGDB00173013 (ppa1027190m)

From PRG Wiki
Jump to: navigation, search
ppa1027190m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Prunus persica

Comment?

Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGGCATTGGCAGTATGCGTGGGTGCTCTAAGAGCAGCATTTCAAATGCTGCTTGATGCGGTTATAGCAGTGAAGGCGGAAACTACCGTGTTTAAGCCTCATCTTGGAAATATCAAATCCACACTAGACTCCTTACAGCCAATGATCGAAGAGATAGAAAAATATAACTCAAAGGAGGGGCTAGAAAATTATACAATGCAAATGGAGGCGGGGGTAAATCTTGTTCGCAAGTGCAGCAAGGTTGGTGTGTGGAGGTGCTGCAGGAAATACAGATACACTAAAAAACTTGATGAATTGGATAGATGCATTCAAAGACTAGTGGATGTGTTGAAAGTGCAGGGCATAAGGGATGTCAGGGAGACCTTGGTTTCGTTAAGGAATATAGAGACGGTGCTGCATCGTATCGAAGGGAACTTTGTGATGCAAAATCAGTCTGAAAAAATCAATGGTTGGCCTGCTGTGCCTGAACCTCCACCGGTTACAGTCGGGTTGGATGTGCCAGTGAAGGAATTGAAGATAAAGCTTCTTCAGGATGATGTGTCCATGCTTGTGCTGACTGCTGCTGGCGGATGTGGGAAAACCACGTTGGCAAAAAAGTTTTGTCAAGATCAGGAAGTAAAAGATAAATTCAAGGACAATATCTTCTTTGTCACTCTTTCCAAGAAGCCCAACTTGGACCTTATTGTACATGAACTATATCAACGGAAGGGTTCCCAGGTGCCTGCTTTCCAAAACGAAGTAATTGCGGTTAACTGGTTGCAACTTTTTCTGAAGGAAACAGGACAAAGTCCTTTACTGATTGTCCTGGATGATGTTTGGTCAGGATCAGAGTCCCTTCTTGAGAAGTTTGATCAATTCAAAATGTCAAATTACAAAGTTTTGGTCACGTCAAGATTTGCATTTCCAAGATTTGGCTCTCCATATCATTTGGAATCATTGAATGATGAAGACGCAATGGCTCTTTTTCGTCATTCAGCATCCTTGGATGATAAGACCTCTTATGCTCGGGAAGACCTTACAAGAAAGATAGTAGAGCTCTGTAAGGGATTTCCACTTGCCATTGCGGAGGTTGGAAGATCACTTCGCTGCCAGCCTATAGAGATTTGGCAAAAAAAAGTACTGGAATGGTCTAAAGGTTCTTCTATACTTGCATCTAACAGTGATTTGCTTGCTTGCCTCCAAAGCAGCTTAGATGCCTTGGATACAGAAAAATCTATCCTCAAGGAATGTTTCCTTGACCTGTGCTCATTTCCTAGAGACCAAAGGATCTCTGCTGCCAACCTCGTAGATATGTGGGCAGAGTTATATGGCCTAGATGAACCCAGTCTGTCCATCGCGAATCTCTACGAACTAACCACGCAGAGTTTAGCTAATCTTGTAGCCACAAGGAATGAGAGAGAGCCGGATGGCTATTACACTGAATACTTTGTTACCCAACATGATATGCTTAGGGAGTTGGCTATTCATCAAGCGAGTCAAGACCCAATAGAACAGAGAAAAAGACTAATTATAAAGACATGTGGAGACAATCTTCCAATGTGGTTGGCAGAGCAAAAGCATCAGCCCCTCCAGGCTCGAATATTATCAATCTCAACTGATGGAGCCTTCTCAAAAAAATGGCCAAACATGCAACTACCAAAAGCAGAGGTTCTAGTTCTAAATTTTGAAACAAACAGCTACGCCTTACCCGAATTTGTGAAGAAAATGGATAATTTAAAGGTTCTAATAGTCACAAATTACGGTTTCTTACCTTCTGAGTTAAATAATTTTCAATTACTTGGTTCCTCATCAAATCTGAAGAGCATTAGATTGGAACGCATTTCAATTCCTTCCATAAGCAAGAACCTCAAACAGTTGAAAAGTGTACAGAAGATATCTTTATTCATGTGTAGCATCGGTCAAGCTTTTGGTAAAGGTTCCATCCAAATTCTAGATGCATTGCCAAATCTAGCTGAAATGCACATAGATTATTGCCATGATCTGGTGGAATTGCCCTCAGAGCTTTGTGATCTTATTCGCCTTAAGAAGCTTAGCATCACCAACTGTCATAACTTATCCGCCTTGCCTGAAAAGATTGGAAAGCTAGTCAGTTTGGAAGTGTTGAGGCTCAGGTCATGTATAGACTTGTTAGAGTTGCCAGGCTCGATTAGGAACCTTAAAAAGTTAAACTTTCTCGACATATCCTATTGCTTGAGCATTAAGGAGTTGCCTGAACACATTGGTGAGATGTGCAGTTTAAAAAAGCTCAACATGAGACAATGCTCAAGATTGCGAGATCTGCCTGCATCAGTTTTGGACCTTGAGCAGTTGAAGAATGTGACATGTGATGAGGAGACAGAACTTTTATGGCAACCCTTCTTACCCCTTCTCAAAAACGTACACATAAAGGCGGTCAAAGAAGATATCAACCTAAATTGGCTCCACAAGCTTCCATCTTGA


Protein sequences

Name Description Sequence
ppa1027190m Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit)

MALAVCVGALRAAFQMLLDAVIAVKAETTVFKPHLGNIKSTLDSLQPMIEEIEKYNSKEGLENYTMQMEAGVNLVRKCSKVGVWRCCRKYRYTKKLDELDRCIQRLVDVLKVQGIRDVRETLVSLRNIETVLHRIEGNFVMQNQSEKINGWPAVPEPPPVTVGLDVPVKELKIKLLQDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKDNIFFVTLSKKPNLDLIVHELYQRKGSQVPAFQNEVIAVNWLQLFLKETGQSPLLIVLDDVWSGSESLLEKFDQFKMSNYKVLVTSRFAFPRFGSPYHLESLNDEDAMALFRHSASLDDKTSYAREDLTRKIVELCKGFPLAIAEVGRSLRCQPIEIWQKKVLEWSKGSSILASNSDLLACLQSSLDALDTEKSILKECFLDLCSFPRDQRISAANLVDMWAELYGLDEPSLSIANLYELTTQSLANLVATRNEREPDGYYTEYFVTQHDMLRELAIHQASQDPIEQRKRLIIKTCGDNLPMWLAEQKHQPLQARILSISTDGAFSKKWPNMQLPKAEVLVLNFETNSYALPEFVKKMDNLKVLIVTNYGFLPSELNNFQLLGSSSNLKSIRLERISIPSISKNLKQLKSVQKISLFMCSIGQAFGKGSIQILDALPNLAEMHIDYCHDLVELPSELCDLIRLKKLSITNCHNLSALPEKIGKLVSLEVLRLRSCIDLLELPGSIRNLKKLNFLDISYCLSIKELPEHIGEMCSLKKLNMRQCSRLRDLPASVLDLEQLKNVTCDEETELLWQPFLPLLKNVHIKAVKEDINLNWLHKLPS*

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-144 RPW8
Powdery mildew resistance protein, RPW8 domain

MALAVCVGALRAAFQMLLDAVIAVKAETTVFKPHLGNIKSTLDSLQPMIEEIEKYNSKEGLENYTMQMEAGVNLVRKCSKVGVWRCCRKYRYTKKLDELDRCIQRLVDVLKVQGIRDVRETLVSLRNIETVLHRIEGNFVMQNQ

HMMPfam: PF05659
IPR008808
6-136 RPW8
Powdery mildew resistance protein, RPW8 domain

CVGALRAAFQMLLDAVIAVKAETTVFKPHLGNIKSTLDSLQPMIEEIEKYNSKEGLENYTMQMEAGVNLVRKCSKVGVWRCCRKYRYTKKLDELDRCIQRLVDVLKVQGIRDVRETLVSLRNIETVLHRIE

HMMPanther: PTHR23155:SF239
13-770 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AFQMLLDAVIAVKAETTVFKPHLGNIKSTLDSLQPMIEEIEKYNSKEGLENYTMQMEAGVNLVRKCSKVGVWRCCRKYRYTKKLDELDRCIQRLVDVLKVQGIRDVRETLVSLRNIETVLHRIEGNFVMQNQSEKINGWPAVPEPPPVTVGLDVPVKELKIKLLQDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKDNIFFVTLSKKPNLDLIVHELYQRKGSQVPAFQNEVIAVNWLQLFLKETGQSPLLIVLDDVWSGSESLLEKFDQFKMSNYKVLVTSRFAFPRFGSPYHLESLNDEDAMALFRHSASLDDKTSYAREDLTRKIVELCKGFPLAIAEVGRSLRCQPIEIWQKKVLEWSKGSSILASNSDLLACLQSSLDALDTEKSILKECFLDLCSFPRDQRISAANLVDMWAELYGLDEPSLSIANLYELTTQSLANLVATRNEREPDGYYTEYFVTQHDMLRELAIHQASQDPIEQRKRLIIKTCGDNLPMWLAEQKHQPLQARILSISTDGAFSKKWPNMQLPKAEVLVLNFETNSYALPEFVKKMDNLKVLIVTNYGFLPSELNNFQLLGSSSNLKSIRLERISIPSISKNLKQLKSVQKISLFMCSIGQAFGKGSIQILDALPNLAEMHIDYCHDLVELPSELCDLIRLKKLSITNCHNLSALPEKIGKLVSLEVLRLRSCIDLLELPGSIRNLKKLNFLDISYCLSIKELPEHIGEMCSLKKLNMRQCSRLRDLPASVLDLEQL

HMMPanther: PTHR23155
13-770 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AFQMLLDAVIAVKAETTVFKPHLGNIKSTLDSLQPMIEEIEKYNSKEGLENYTMQMEAGVNLVRKCSKVGVWRCCRKYRYTKKLDELDRCIQRLVDVLKVQGIRDVRETLVSLRNIETVLHRIEGNFVMQNQSEKINGWPAVPEPPPVTVGLDVPVKELKIKLLQDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKDNIFFVTLSKKPNLDLIVHELYQRKGSQVPAFQNEVIAVNWLQLFLKETGQSPLLIVLDDVWSGSESLLEKFDQFKMSNYKVLVTSRFAFPRFGSPYHLESLNDEDAMALFRHSASLDDKTSYAREDLTRKIVELCKGFPLAIAEVGRSLRCQPIEIWQKKVLEWSKGSSILASNSDLLACLQSSLDALDTEKSILKECFLDLCSFPRDQRISAANLVDMWAELYGLDEPSLSIANLYELTTQSLANLVATRNEREPDGYYTEYFVTQHDMLRELAIHQASQDPIEQRKRLIIKTCGDNLPMWLAEQKHQPLQARILSISTDGAFSKKWPNMQLPKAEVLVLNFETNSYALPEFVKKMDNLKVLIVTNYGFLPSELNNFQLLGSSSNLKSIRLERISIPSISKNLKQLKSVQKISLFMCSIGQAFGKGSIQILDALPNLAEMHIDYCHDLVELPSELCDLIRLKKLSITNCHNLSALPEKIGKLVSLEVLRLRSCIDLLELPGSIRNLKKLNFLDISYCLSIKELPEHIGEMCSLKKLNMRQCSRLRDLPASVLDLEQL

superfamily: SSF52540
141-375 P-loop containing nucleoside triphosphate hydrolases

MQNQSEKINGWPAVPEPPPVTVGLDVPVKELKIKLLQDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKDNIFFVTLSKKPNLDLIVHELYQRKGSQVPAFQNEVIAVNWLQLFLKETGQSPLLIVLDDVWSGSESLLEKFDQFKMSNYKVLVTSRFAFPRFGSPYHLESLNDEDAMALFRHSASLDDKTSYAREDLTRKIVELCKGFPLAIAEVGRSLRCQPIEIWQKKVLE

HMMPfam: PF00931
IPR002182
168-433 NB-ARC,NBS
NB-ARC

VKELKIKLLQDDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKDNIFFVTLSKKPNLDLIVHELYQRKGSQVPAFQNEVIAVNWLQLFLKETGQSPLLIVLDDVWSGSESLLEKFDQFKMSNYKVLVTSRFAFPRFGSPYHLESLNDEDAMALFRHSASLDDKTSYAREDLTRKIVELCKGFPLAIAEVGRSLRCQPIEIWQKKVLEWSKGSSILASNSDLLACLQSSLDALDTEKSILKECFLDLCSFPRDQRISAANLVDMWA

Gene3D: G3DSA:3.40.50.300
178-287 no description

DDVSMLVLTAAGGCGKTTLAKKFCQDQEVKDKFKDNIFFVTLSKKPNLDLIVHELYQRKGSQVPAFQNEVIAVNWLQLFLKETGQSPLLIVLDDVWSGSESLLEKFDQFK

FPrintScan: PR00364
IPR000767
182-197 DISEASERSIST
Disease resistance protein

MLVLTAAGGCGKTTLA

FPrintScan: PR00364
IPR000767
259-273 DISEASERSIST
Disease resistance protein

ETGQSPLLIVLDDVW

FPrintScan: PR00364
IPR000767
347-361 DISEASERSIST
Disease resistance protein

CKGFPLAIAEVGRSL

superfamily: SSF52047
545-773 RNI-like,LRR

LPKAEVLVLNFETNSYALPEFVKKMDNLKVLIVTNYGFLPSELNNFQLLGSSSNLKSIRLERISIPSISKNLKQLKSVQKISLFMCSIGQAFGKGSIQILDALPNLAEMHIDYCHDLVELPSELCDLIRLKKLSITNCHNLSALPEKIGKLVSLEVLRLRSCIDLLELPGSIRNLKKLNFLDISYCLSIKELPEHIGEMCSLKKLNMRQCSRLRDLPASVLDLEQLKNV

Gene3D: G3DSA:3.80.10.10
549-774 no description

EVLVLNFETNSYALPEFVKKMDNLKVLIVTNYGFLPSELNNFQLLGSSSNLKSIRLERISIPSISKNLKQLKSVQKISLFMCSIGQAFGKGSIQILDALPNLAEMHIDYCHDLVELPSELCDLIRLKKLSITNCHNLSALPEKIGKLVSLEVLRLRSCIDLLELPGSIRNLKKLNFLDISYCLSIKELPEHIGEMCSLKKLNMRQCSRLRDLPASVLDLEQLKNVT

FPrintScan: PR00364
IPR000767
717-733 DISEASERSIST
Disease resistance protein

RNLKKLNFLDISYCLSI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox