PRGDB00174138 (ppa014998m)

From PRG Wiki
Jump to: navigation, search
ppa014998m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Prunus persica

Comment?

Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGGCACTGGAGTTAATCGGAGGGGCTGGTCTAGGAGCAGTATTTGCAATGCTGTATGATGTGGTAAAGATAAAAATGGATAAGGGTGTGAAATTGAGACCCTTGGGAGCTCTCAAATCCACCCTAGACTCTTTGCAACCGCTGATCATTGCACAAATAGAAGAGCACAATGTGCAACTGGGTCTTCCTAACGACTTAATAGAGAATCTCAAAATACAAATGGAGGAAGGGACAAGGTTGGTTCAAGGGTTGTCCAATCTTCACATCTTGCACTTGATGTTCAACTGCACAACCCACCACACCGAGCAGCTTGTCACGTTGGATGACCGTCTTAAGATGCTGTCGGAGAGCCTAAAGATACAGGAAGCAAGGGATATGAAGGAGACATTGCTTTTGGCAAGACAAAGCGCCAAAAAGCTCGTTGAATTCGAAGGTTATAACAGGGAACAGTTGGAAACTCTGAGGCTGCAAGTGCAACAGCAAGAGCAACCAAGTGCTCTGAAGGAGACGTTGGCTTTGGCAAGAGAAAGTGCGAAAGCGCTTGCTGGAATGAAAGGGTCTATTAGAAGGCTGCTGGCTACACTAGAGCTGCAGCTGGAATCGGAAATGGACATGGAGACCTTTGGTTCAGTAAAAAATATAGAGTCTGCTCTCGAGCGAGCTGAAAAAGGCAGTGCGGTACAAGCAGTGGCATCGATAGTCGAAGGGGCTGCTCTAGCAGCAGCATTTGGGGAGCTGTTTGATGCTGTTGTAGGAGTGAAGGACAATACTGCGATGTTTAGGCTCCTGCTTGGAGATCTTGATTCCACGCTATACTCTTTAAAACCATTTATCGCGAAAACAGTAGAATATACCAATGTGGATTGCCCCTATACAGAGGAACTGGAAAATTATAAAATGCAAATGGAGGAGGGTGAGAAGCTTGTTCGTAAGTGCTCCAAGGTCAGGCTGTGGAGCAGTTACAAAAAGTATAAATACACCGACCAACTTGTTGCATTGGATAAATCTCTTCAAAGACTTGTAGTACCTCCACTTCCATCGGTTCCTGTTGGCTTGGATGCGCCTTTGGATGATCTGAAGATGACGCTCCTTGGGGATGGCCCCGAGTCAATACTTGTGCTTACTGCTCCTGGGGGATGCGGGAAAACCACTTTGGCAACAATGTTTTGTCATGATCCGAAAGTTAAAGATAAGTTCAAGGAAAATATCTTCTTTGCCACTGTTTCGAGTAAGGTCAGCTACCTTATTGTACAAGAACTATGTGAACATGCGGGATTGGAGGTACCCGCTTTACAAAATGAAGAAAATCCGTTTAAATGGCTGCAAAAGTTTATGGAGGAAAGAGGAAAAAATCCTTTACTATTGGTCTTGGATGATGTTCAGTCTAGATCAGAATCCCTTCTTGACAGGTTTAATGAATTCAAAATGTCAAGTTGCAAGGTTTTGGTGACATCCAGATATCGTTTTCCAAAATTTGGTCGTACATATCCTTTAGAAACATTGGAAGATAAATATGCTATGGCTCTTTTTCGTGATTCAGCATTCCTACCAAACACGAGCTCTAACATACCAGATGATCTTCAGGAAGAGATCGTACGGTTGTGTAAGAGATTTCCACTTTCCCTTAAAGCGATTGGAGACTCACTTCGCAATCAACGTATAGAGATCTGGAAAAAAAGACTAATGGAATTGTCTAAAGGTTCTATTCTTGAAGCAGACGAAAAGTTGCTTGCTTACCTCAAAAGTTGCTTAGATGACTTGGGCAAAGGAATGGCTGCCGTCAAGAATTGTTTCATAGACCTTGGTTTATTTCCTGAAGACCGAATAATCCCCGTTACTGCCCTCCTGGATATGTGGGCAGAGTATAAGGGAACTAAAGATATTCTGTCCATTGCAAACCTCTACGATCTCACCAATCGCAATCTGGCCCGCCTTGTAGTAGTCACAGGCAACGAGGACGTGGATGGCTATTATGGCGAGCACTTTGTTATCCAACATGATATGCTTAGATTGCTATCGATCCATGAGAGTTGTGAAGACCCGGAACAACAGAGACTGATAATAGAAATACGTGGAGACGAGCTTCCAACATGGTGGAAAGAGAGGAAGCATAAAACGAAGAAGGCTCGCTTAGTATCTATCTCAACTGATGGATTGTCAGCAACATGGCACAACATGGATCTACCAAAAGCTGAGGTCTTAGTTTTGAATTTTCAGACAGGGAACTGTGTTTTACCCAAGTTCGTGAAGCAAATGTCCAAGTTGAAGGTTCTAATAGTCACAAGTTATGGTGTCTTACAAGCTGACTTGAGTAATTTCAAGCTTTTGGGTTCTTTGGCTAATCTGAAGAGAATAAGATTAGAGGGCATTTCAATTCCTTCCATAAGCGAGAAATCCATGCAGTTGAAGGGTCTGCAGAAGATATCTTTATTCATGTGCAGCATCGGTCAAGCTTTTAGCAACTCTTCCATCCAAATCTTAGAGGCATTTCCCAATCTAGTGGAATTGAACATTGACTATTGCAATGATTTGGTGGAATTGCCTGCCAAGCTCTGTGATCTTATCCATCTAAAAAAGCTCAGTATTACCAATTGCGTTCAACTATCTGCCTTGCCTGACGAGATTGGAAAGCTGGATGGTTTAGAGGTCTTGAGGCTAAGGTCCTGCACAGATTTGGAACGGCTTCCAGATTCGATTAAGAACCTCTCTAAGTTAAACCTTCTTGACATGTATTATTGTTTCAACATTAAGGAGTTGCCTGAAGAGATTGGTGAAATGAGTGGTTTAAGAAAGATCAAGATGGTACAATGCTTAAGATTGCTGGCGTTGCCTGTATCAGTTTTGAATCTTGAGCAGTTACGGGAAGTGATATGCGACAAAGATACAGAAAATTTGTGGGGGGAACCTTTCAAATCCAGTCTCACAAACATAAACATAAGGGTGGTGGAAGAAGACTTCAAACGGAATTGGCTCCACGATCTTTGA


Protein sequences

Name Description Sequence
ppa014998m Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit)

MALELIGGAGLGAVFAMLYDVVKIKMDKGVKLRPLGALKSTLDSLQPLIIAQIEEHNVQLGLPNDLIENLKIQMEEGTRLVQGLSNLHILHLMFNCTTHHTEQLVTLDDRLKMLSESLKIQEARDMKETLLLARQSAKKLVEFEGYNREQLETLRLQVQQQEQPSALKETLALARESAKALAGMKGSIRRLLATLELQLESEMDMETFGSVKNIESALERAEKGSAVQAVASIVEGAALAAAFGELFDAVVGVKDNTAMFRLLLGDLDSTLYSLKPFIAKTVEYTNVDCPYTEELENYKMQMEEGEKLVRKCSKVRLWSSYKKYKYTDQLVALDKSLQRLVVPPLPSVPVGLDAPLDDLKMTLLGDGPESILVLTAPGGCGKTTLATMFCHDPKVKDKFKENIFFATVSSKVSYLIVQELCEHAGLEVPALQNEENPFKWLQKFMEERGKNPLLLVLDDVQSRSESLLDRFNEFKMSSCKVLVTSRYRFPKFGRTYPLETLEDKYAMALFRDSAFLPNTSSNIPDDLQEEIVRLCKRFPLSLKAIGDSLRNQRIEIWKKRLMELSKGSILEADEKLLAYLKSCLDDLGKGMAAVKNCFIDLGLFPEDRIIPVTALLDMWAEYKGTKDILSIANLYDLTNRNLARLVVVTGNEDVDGYYGEHFVIQHDMLRLLSIHESCEDPEQQRLIIEIRGDELPTWWKERKHKTKKARLVSISTDGLSATWHNMDLPKAEVLVLNFQTGNCVLPKFVKQMSKLKVLIVTSYGVLQADLSNFKLLGSLANLKRIRLEGISIPSISEKSMQLKGLQKISLFMCSIGQAFSNSSIQILEAFPNLVELNIDYCNDLVELPAKLCDLIHLKKLSITNCVQLSALPDEIGKLDGLEVLRLRSCTDLERLPDSIKNLSKLNLLDMYYCFNIKELPEEIGEMSGLRKIKMVQCLRLLALPVSVLNLEQLREVICDKDTENLWGEPFKSSLTNINIRVVEEDFKRNWLHDL*

Domains

Domain Start-End Description Sequence

Seg: seg
2-13 seg

ALELIGGAGLGA

HMMPfam: PF05659
IPR008808
4-140 RPW8
Powdery mildew resistance protein, RPW8 domain

ELIGGAGLGAVFAMLYDVVKIKMDKGVKLRPLGALKSTLDSLQPLIIAQIEEHNVQLGLPNDLIENLKIQMEEGTRLVQGLSNLHILHLMFNCTTHHTEQLVTLDDRLKMLSESLKIQEARDMKETLLLARQSAKKL

HMMPanther: PTHR23155
34-953 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PLGALKSTLDSLQPLIIAQIEEHNVQLGLPNDLIENLKIQMEEGTRLVQGLSNLHILHLMFNCTTHHTEQLVTLDDRLKMLSESLKIQEARDMKETLLLARQSAKKLVEFEGYNREQLETLRLQVQQQEQPSALKETLALARESAKALAGMKGSIRRLLATLELQLESEMDMETFGSVKNIESALERAEKGSAVQAVASIVEGAALAAAFGELFDAVVGVKDNTAMFRLLLGDLDSTLYSLKPFIAKTVEYTNVDCPYTEELENYKMQMEEGEKLVRKCSKVRLWSSYKKYKYTDQLVALDKSLQRLVVPPLPSVPVGLDAPLDDLKMTLLGDGPESILVLTAPGGCGKTTLATMFCHDPKVKDKFKENIFFATVSSKVSYLIVQELCEHAGLEVPALQNEENPFKWLQKFMEERGKNPLLLVLDDVQSRSESLLDRFNEFKMSSCKVLVTSRYRFPKFGRTYPLETLEDKYAMALFRDSAFLPNTSSNIPDDLQEEIVRLCKRFPLSLKAIGDSLRNQRIEIWKKRLMELSKGSILEADEKLLAYLKSCLDDLGKGMAAVKNCFIDLGLFPEDRIIPVTALLDMWAEYKGTKDILSIANLYDLTNRNLARLVVVTGNEDVDGYYGEHFVIQHDMLRLLSIHESCEDPEQQRLIIEIRGDELPTWWKERKHKTKKARLVSISTDGLSATWHNMDLPKAEVLVLNFQTGNCVLPKFVKQMSKLKVLIVTSYGVLQADLSNFKLLGSLANLKRIRLEGISIPSISEKSMQLKGLQKISLFMCSIGQAFSNSSIQILEAFPNLVELNIDYCNDLVELPAKLCDLIHLKKLSITNCVQLSALPDEIGKLDGLEVLRLRSCTDLERLPDSIKNLSKLNLLDMYYCFNIKELPEEIGEMSGLRKIKMVQCLRLLALPVSVLNLEQL

HMMPanther: PTHR23155:SF239
34-953 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

PLGALKSTLDSLQPLIIAQIEEHNVQLGLPNDLIENLKIQMEEGTRLVQGLSNLHILHLMFNCTTHHTEQLVTLDDRLKMLSESLKIQEARDMKETLLLARQSAKKLVEFEGYNREQLETLRLQVQQQEQPSALKETLALARESAKALAGMKGSIRRLLATLELQLESEMDMETFGSVKNIESALERAEKGSAVQAVASIVEGAALAAAFGELFDAVVGVKDNTAMFRLLLGDLDSTLYSLKPFIAKTVEYTNVDCPYTEELENYKMQMEEGEKLVRKCSKVRLWSSYKKYKYTDQLVALDKSLQRLVVPPLPSVPVGLDAPLDDLKMTLLGDGPESILVLTAPGGCGKTTLATMFCHDPKVKDKFKENIFFATVSSKVSYLIVQELCEHAGLEVPALQNEENPFKWLQKFMEERGKNPLLLVLDDVQSRSESLLDRFNEFKMSSCKVLVTSRYRFPKFGRTYPLETLEDKYAMALFRDSAFLPNTSSNIPDDLQEEIVRLCKRFPLSLKAIGDSLRNQRIEIWKKRLMELSKGSILEADEKLLAYLKSCLDDLGKGMAAVKNCFIDLGLFPEDRIIPVTALLDMWAEYKGTKDILSIANLYDLTNRNLARLVVVTGNEDVDGYYGEHFVIQHDMLRLLSIHESCEDPEQQRLIIEIRGDELPTWWKERKHKTKKARLVSISTDGLSATWHNMDLPKAEVLVLNFQTGNCVLPKFVKQMSKLKVLIVTSYGVLQADLSNFKLLGSLANLKRIRLEGISIPSISEKSMQLKGLQKISLFMCSIGQAFSNSSIQILEAFPNLVELNIDYCNDLVELPAKLCDLIHLKKLSITNCVQLSALPDEIGKLDGLEVLRLRSCTDLERLPDSIKNLSKLNLLDMYYCFNIKELPEEIGEMSGLRKIKMVQCLRLLALPVSVLNLEQL

ProfileScan: PS51153
IPR008808
228-379 RPW8
Powdery mildew resistance protein, RPW8 domain

QAVASIVEGAALAAAFGELFDAVVGVKDNTAMFRLLLGDLDSTLYSLKPFIAKTVEYTNVDCPYTEELENYKMQMEEGEKLVRKCSKVRLWSSYKKYKYTDQLVALDKSLQRLVVPPLPSVPVGLDAPLDDLKMTLLGDGPESILVLTAPGG

HMMPfam: PF05659
IPR008808
230-341 RPW8
Powdery mildew resistance protein, RPW8 domain

VASIVEGAALAAAFGELFDAVVGVKDNTAMFRLLLGDLDSTLYSLKPFIAKTVEYTNVDCPYTEELENYKMQMEEGEKLVRKCSKVRLWSSYKKYKYTDQLVALDKSLQRLV

Seg: seg
235-247 seg

EGAALAAAFGELF

superfamily: SSF52540
332-564 P-loop containing nucleoside triphosphate hydrolases

ALDKSLQRLVVPPLPSVPVGLDAPLDDLKMTLLGDGPESILVLTAPGGCGKTTLATMFCHDPKVKDKFKENIFFATVSSKVSYLIVQELCEHAGLEVPALQNEENPFKWLQKFMEERGKNPLLLVLDDVQSRSESLLDRFNEFKMSSCKVLVTSRYRFPKFGRTYPLETLEDKYAMALFRDSAFLPNTSSNIPDDLQEEIVRLCKRFPLSLKAIGDSLRNQRIEIWKKRLMEL

Seg: seg
337-352 seg

LQRLVVPPLPSVPVGL

HMMPfam: PF00931
IPR002182
356-621 NB-ARC,NBS
NB-ARC

LDDLKMTLLGDGPESILVLTAPGGCGKTTLATMFCHDPKVKDKFKENIFFATVSSKVSYLIVQELCEHAGLEVPALQNEENPFKWLQKFMEERGKNPLLLVLDDVQSRSESLLDRFNEFKMSSCKVLVTSRYRFPKFGRTYPLETLEDKYAMALFRDSAFLPNTSSNIPDDLQEEIVRLCKRFPLSLKAIGDSLRNQRIEIWKKRLMELSKGSILEADEKLLAYLKSCLDDLGKGMAAVKNCFIDLGLFPEDRIIPVTALLDMWAE

Gene3D: G3DSA:3.40.50.300
366-474 no description

DGPESILVLTAPGGCGKTTLATMFCHDPKVKDKFKENIFFATVSSKVSYLIVQELCEHAGLEVPALQNEENPFKWLQKFMEERGKNPLLLVLDDVQSRSESLLDRFNEF

FPrintScan: PR00364
IPR000767
371-386 DISEASERSIST
Disease resistance protein

ILVLTAPGGCGKTTLA

FPrintScan: PR00364
IPR000767
447-461 DISEASERSIST
Disease resistance protein

ERGKNPLLLVLDDVQ

FPrintScan: PR00364
IPR000767
535-549 DISEASERSIST
Disease resistance protein

CKRFPLSLKAIGDSL

Gene3D: G3DSA:3.80.10.10
720-937 no description

SATWHNMDLPKAEVLVLNFQTGNCVLPKFVKQMSKLKVLIVTSYGVLQADLSNFKLLGSLANLKRIRLEGISIPSISEKSMQLKGLQKISLFMCSIGQAFSNSSIQILEAFPNLVELNIDYCNDLVELPAKLCDLIHLKKLSITNCVQLSALPDEIGKLDGLEVLRLRSCTDLERLPDSIKNLSKLNLLDMYYCFNIKELPEEIGEMSGLRKIKMVQC

superfamily: SSF52047
744-959 RNI-like,LRR

VLPKFVKQMSKLKVLIVTSYGVLQADLSNFKLLGSLANLKRIRLEGISIPSISEKSMQLKGLQKISLFMCSIGQAFSNSSIQILEAFPNLVELNIDYCNDLVELPAKLCDLIHLKKLSITNCVQLSALPDEIGKLDGLEVLRLRSCTDLERLPDSIKNLSKLNLLDMYYCFNIKELPEEIGEMSGLRKIKMVQCLRLLALPVSVLNLEQLREVICD

FPrintScan: PR00364
IPR000767
900-916 DISEASERSIST
Disease resistance protein

KNLSKLNLLDMYYCFNI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox