PRGDB00174162 (ppa001475m)

From PRG Wiki
Jump to: navigation, search
ppa001475m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CN
Domain Type Ser-Thr Kinase, NBS
Gene Species Prunus persica

Comment?

U-box domain-containing protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGAGCTCATACAGCCTTCACATCCATTGCACGGCTCAGCTGGTGAATCCCTTTCTGGGTTCTCGTCTCCGGTGAGTTTCCGACGTGGGTTTGACCGGCCGCCCACTACCTCTCATTTGGCTGAGATTTTTGAAGAAGAAGATAATGGTGGCGGCGTTGATAAGGTACATGTGGCAGTTGGCAAGTCTGTTGAGAAAGCTGTGAGCTTGCTTCATTGGACTTTCAAGCACTTTGGCTGTAAAGAAATTTGTATACTTCATGTTCATCAGCCTTCTCAGCTCATTCCGACACTCTTAGGAAAGCTACCAGCAAGTCAAGCAAATGCCGAAGTGGTGTCTGCTTTCAGAAGGGAGGAAGGGGAACGGAAAATGAAGATTTTGCAAAATTATTTGAGGGTTTGCTCTAGAGCAAAGGTTAAAGCAAGCATTGCCATGGTTGAAGCTAATGAAATTCAGAAGGGAATTGTAGACTTGGTCAACAGACATGGGGTTAGGAAGCTTGTTATGGGGGCTGTACCAGAAAATTGCATGAAGGTGAAAAAGAACTCCAGCAAAGCAAATTATGCTGCCAAATATGCTGCCTTGTTTTGTGAAATATGGTTTGTCAACAAAGGGAAACATGTCTGGACGAGAGATGCTTCAGAAGGCCAAAGTTCTCCGCCTTCATGTAGGCAACTGCAGATTGCCAAAGTTCTCCCTCGAGAAAATAAGGAATTTCACCAAGAATCGGCTGCATCACCAACTTTATCTTGTTCTACAAATACATCCTTACCCTACAATATTCATAATTCAATTAGTTCAAGTACAAGCTCTGGTTCAGGATATAATTCTGCCGAGGGAATGATGCCTTCAGATTCTGATATAAATGTTGAGGAACAGAGTTTATATGGTAGGCTTGCAGAAGCTACTTTAGAAGCTGAGGCATCAAAGGACAATGCATTTGCAGAGCTATTGAAGCGCAAACATTTAGAATCAGAAGCTATGAAAGCTATCTACAAGGTCAAGCAATTTGAGTTAGCCCATGCCTGTGAAGTTAAACTTAGAACAGAGGCTGAGGATGCCCTGAGAACTACGATAGGGGAACAACAAAAACTCTTGCAAGAGAAAGAAGAAGTTAGTAGAGAGATAAGGAGGACCATGACAAATATTGCCCTTCTAGACAGTCGAGCACAGGAAGCAAATCGTAGGTTTAATGAAGCTTCTGGGGAAGTGAAACTAATTCAGACTTCAATTGCAACTCTTCAGCAAGAAAAACAGAGTATTCAACGACAGAAGATGGAAGCCCTACGCTGGCTTGAGCGGTGGAGAAATCATCGACAGGCTGGAGCTGCAAACTGCAATGGGCTCGTTGGGTCTGCTGAAGAACTGCCAAAGTTGTCAGAATTCTCATTGTCAGATCTACAAACTGCAACATGCAATTTTTCTGAGAGCTTTAAAATTGGGCAGGGAGGATATGGTTGTGTTTTTAAGGGGGAAATGATGGGCAGAACTGTCGCTATAAGGAAGTTGCATCCACATAACATGCAAGGACAAGCAGAGTTTCAACAAGAGGTACAAGTACTTGGAAAATTACAGCATCCTCATCTTGTGACCTTGCTTGGTGTGTGTCCAGAAGCCTGGTCGCTTGTGTATGAGCACTTATCCAATGGGAGCCTCCAAGACCATCTTTTCAGGAAAAGCAACGGTTCATCAGTGCCATGGAAGACCCGAACACGGATAATTGCTGAAATATCTAGTGCCCTTTGCTTCTTGCACTCTTCTAAACCTGAAAAGATTGTCCATGGTGATTTGAAGCCCCAAAACATCCTACTAGATTCAGAACTTAGCTGCAAGATTTGTGATTTTGGGATTTGCAGGCTGGTAACTGAAGACAATCTTTATTGTCGAAGTTTCCGCCGGGGTACTGAGCCAAAGGGTGCTTTTCCTTACACAGATCCAGAGCTTCAGAGAATTGGAGTCCTGACTCCCAAGTCTGATATTTATTCCTTTGGGCTAATCATTCTCCAGTTAGTCACCAGACGGCCTCCAGTTGGCTTAGCAAGTGAGGTGCGCAAGGCAGTTTTATGTGGAAACTTGGCATCAATTCTGGATTCCTCAGCTGGAGAATGGCCTATAACTGTGGCAAGGCGATTGGTAGACCTTGGGCTGCAATGCTGTGAATTGAATAGTAGCGAAAGACCAGAGATTACACCGGCTTTAGTGAGGGAATTGCATCAGTTGCATGCCCCTGAAGAGCGACCAGTGCCATCTTTTTTCTTGTGCCCGATCCTTCAGGAAATAATGCACGACCCTCAGGTGGCAGCTGATGGCTTCACTTACGAAGGTGAAGCTTTGCGTGGTTGGTTGCAAAATTGTCGCGAAACGTCTCCGATGACCAATTTGAAATTGAGTAACTTGCATCTCACTCCCAACCATGCCCTACGGCATGCTATACAAGATTGGCTTTGCAAGTCTTGA


Protein sequences

Name Description Sequence
ppa001475m U-box domain-containing protein kinase family protein (best arabidopsis hit)

MELIQPSHPLHGSAGESLSGFSSPVSFRRGFDRPPTTSHLAEIFEEEDNGGGVDKVHVAVGKSVEKAVSLLHWTFKHFGCKEICILHVHQPSQLIPTLLGKLPASQANAEVVSAFRREEGERKMKILQNYLRVCSRAKVKASIAMVEANEIQKGIVDLVNRHGVRKLVMGAVPENCMKVKKNSSKANYAAKYAALFCEIWFVNKGKHVWTRDASEGQSSPPSCRQLQIAKVLPRENKEFHQESAASPTLSCSTNTSLPYNIHNSISSSTSSGSGYNSAEGMMPSDSDINVEEQSLYGRLAEATLEAEASKDNAFAELLKRKHLESEAMKAIYKVKQFELAHACEVKLRTEAEDALRTTIGEQQKLLQEKEEVSREIRRTMTNIALLDSRAQEANRRFNEASGEVKLIQTSIATLQQEKQSIQRQKMEALRWLERWRNHRQAGAANCNGLVGSAEELPKLSEFSLSDLQTATCNFSESFKIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLLGVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPALVRELHQLHAPEERPVPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLQNCRETSPMTNLKLSNLHLTPNHALRHAIQDWLCKS*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.620
IPR014729
61-172 no description
Rossmann-like alpha/beta/alpha sandwich fold

GKSVEKAVSLLHWTFKHFGCKEICILHVHQPSQLIPTLLGKLPASQANAEVVSAFRREEGERKMKILQNYLRVCSRAKVKASIAMVEANEIQKGIVDLVNRHGVRKLVMGAV

Seg: seg
180-194 seg

KKNSSKANYAAKYAA

HMMPanther: PTHR24420
197-794 FAMILY NOT NAMED,FAMILY NOT NAMED

CEIWFVNKGKHVWTRDASEGQSSPPSCRQLQIAKVLPRENKEFHQESAASPTLSCSTNTSLPYNIHNSISSSTSSGSGYNSAEGMMPSDSDINVEEQSLYGRLAEATLEAEASKDNAFAELLKRKHLESEAMKAIYKVKQFELAHACEVKLRTEAEDALRTTIGEQQKLLQEKEEVSREIRRTMTNIALLDSRAQEANRRFNEASGEVKLIQTSIATLQQEKQSIQRQKMEALRWLERWRNHRQAGAANCNGLVGSAEELPKLSEFSLSDLQTATCNFSESFKIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLLGVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPALVRELHQLHAPEERPVPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLQNCRETSPMTNL

HMMPanther: PTHR24420:SF448
197-794 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CEIWFVNKGKHVWTRDASEGQSSPPSCRQLQIAKVLPRENKEFHQESAASPTLSCSTNTSLPYNIHNSISSSTSSGSGYNSAEGMMPSDSDINVEEQSLYGRLAEATLEAEASKDNAFAELLKRKHLESEAMKAIYKVKQFELAHACEVKLRTEAEDALRTTIGEQQKLLQEKEEVSREIRRTMTNIALLDSRAQEANRRFNEASGEVKLIQTSIATLQQEKQSIQRQKMEALRWLERWRNHRQAGAANCNGLVGSAEELPKLSEFSLSDLQTATCNFSESFKIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLLGVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPALVRELHQLHAPEERPVPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLQNCRETSPMTNL

Seg: seg
259-277 seg

YNIHNSISSSTSSGSGYNS

Seg: seg
361-371 seg

EQQKLLQEKEE

Coil: coil
362-425 coiled-coil

QQKLLQEKEEVSREIRRTMTNIALLDSRAQEANRRFNEASGEVKLIQTSIATLQQEKQSIQRQK

superfamily: SSF56112
IPR011009
446-759 Protein kinase-like (PK-like)
Protein kinase-like domain

CNGLVGSAEELPKLSEFSLSDLQTATCNFSESFKIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLLGVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPALVRELHQLHAPEERPVPSFFLCPILQE

Gene3D: G3DSA:3.30.200.20
458-533 no description

KLSEFSLSDLQTATCNFSESFKIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLL

ProfileScan: PS50011
IPR000719
474-741 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSESFKIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLLGVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPALVRELHQLH

HMMSmart: SM00219
IPR020635
474-737 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSESFKIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLLGVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPALVREL

HMMSmart: SM00220
IPR002290
474-741 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSESFKIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLLGVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPALVRELHQLH

HMMPfam: PF00069
IPR000719
479-733 Pkinase,Ser-thr
Protein kinase, catalytic domain

KIGQGGYGCVFKGEMMGRTVAIRKLHPHNMQGQAEFQQEVQVLGKLQHPHLVTLLGVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPAL

PatternScan: PS00107
IPR017441
480-502 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGYGCVFKGEMMGRTVAIRK

Gene3D: G3DSA:1.10.510.10
534-734 no description

GVCPEAWSLVYEHLSNGSLQDHLFRKSNGSSVPWKTRTRIIAEISSALCFLHSSKPEKIVHGDLKPQNILLDSELSCKICDFGICRLVTEDNLYCRSFRRGTEPKGAFPYTDPELQRIGVLTPKSDIYSFGLIILQLVTRRPPVGLASEVRKAVLCGNLASILDSSAGEWPITVARRLVDLGLQCCELNSSERPEITPALV

PatternScan: PS00108
IPR008271
592-604 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHGDLKPQNILL

superfamily: SSF57850
747-818 RING/U-box,NBS

PVPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLQNCRETSPMTNLKLSNLHLTPNHALRHAIQDWLCKS

Gene3D: G3DSA:3.30.40.10
IPR013083
748-815 no description
Zinc finger, RING/FYVE/PHD-type

VPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLQNCRETSPMTNLKLSNLHLTPNHALRHAIQDWL

HMMPfam: PF04564
IPR003613
748-817 U-box
U box domain

VPSFFLCPILQEIMHDPQVAADGFTYEGEALRGWLQNCRETSPMTNLKLSNLHLTPNHALRHAIQDWLCK

HMMSmart: SM00504
IPR003613
751-814 Modified RING finger domain
U box domain

FFLCPILQEIMHDPQVAADGFTYEGEALRGWLQNCRETSPMTNLKLSNLHLTPNHALRHAIQDW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox