PRGDB00174283 (POPTR_0005s06530.1)

From PRG Wiki
Jump to: navigation, search
POPTR_0005s06530.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CN
Domain Type NBS
Gene Species Populus trichocarpa

Comment?

ABC-2 type transporter family protein (best arabidopsis hit)

DNA Sequence

ATGAAGAAGCAAGGTTGTGAGATTGAAGCAATAGGGATTTCCTACAAAATCTCAACCAAGAAAAGAGAGCACCCTTTTAAAATCTTCACCAAAAAGCAAGAAATAAATGAAGAACCAAAGCAAGTGACGGATCTCGAAGAAGCAAGCCTTGGAGCTAAGCATGTCTTGAAAGATGTTTTTTGCAAAGCAAAGCCATGGGAAATCCTTGCCATTGTTGGTCCAAGTGGAGCTGGAAAATCATCCTTGCTTGAAATCCTAGCTGGGAAACTCACCCCACAAAATGGTACCATTTTTGTCAACCAAAACCCTATTGACAAAGCTCGGTTCAAGAAGATTTCAGGCTATGTCACACAAAAAGACACCCTCTTTCCTCTCCTTACAGTCGAAGAAACACTCATGTTTAGTGCCAAACTGCGTCTAAGGCTTCCTCAAGCTCAACTGAGCTCTAATGTTAAGTCCCTGATGAAGGAGTTAGGCCTGGATCACGTAGCCATGACTCGAGTTGGCGACGACAGGATTCGTGGGATATCAGGCGGAGAAAGGCGTCGTGTGTCGATAGGAGTTGATGCCATTCATGATCCTGAAGTGCTAATTCTTGATGAACCAACTTCTGGTCTTGATAGCACTTCTGCTTTACAAATTATTGATATGCTCAAGGTCATGGCAGAGACAAGAGGTCGAACCATAATACTAAGCATTCATCAACCCGGATTTCGGATTGTGAAGTTGTTCAACTCAATACTTATGATGGCTAATGGATCAGTCTTGCATCATGGCACGGTGGATCAGCTTGGTGTTAATTTGAGGACAATGGGAATGCAGCTTCCTATTCATGTCAATGTTGTTGAATTTGCCATTGAGTCCATTGAAACCATTCAACAGCAAAGAGAAGTCTTGCAGAAAGAAATGCAACCCCAAGTGCTAACATCATCAACAACAAAACCACAGCAGAAGAAAATAGAAGAAGTTGGCGAGGGTAGAAGTGGCAAGTTCACTCTTCAACAGCTCTTTCAGCAATCGAAAGTAGTTGATGAGGAAATTATCAATGTTGAGTTTGATTTTCCTCTTGGTTTTGCTAATTCAAGGTTGCAAGAAACTTTGATCCTCACTCATAGGTTCTCCAAGAACATTTTCAGAACCAAGGAGCTTTTCGCATGCCGGACAATTCAAATGCTGATTTCTGGACTTGTTTTGGGCTCTATCTTCTACAACCTTGAAGATGATTTGATTGGAGCAGAAGAAAGGGTAGGCCTATTTGCTTTTATATTGACTTTCTTGTTATCTTGCACAACAGAAGCTCTACCAATCTTCTTGCAAGAAAGGGAGATTCTTATGAAGGAGACATCTTGTGGGAGCTATAGAGTCTCATCATACGCCATAGCCAATGGACTCGTTTACTTGCCATTTCTACTCATCCTAGCCATATTATTCACAATTCCACTATATTGGCTAGTGGGGCTCAATCCAAATTTCATTGCATTCATGCATTTCCTGTTGTTGATTTGGTTGATTCTCTACACAGCGAATTCAGTTGTGGTGTGTTTCAGTGCTCTAGTGCCTAACTTCATCGTTGGAAATTCAGTTATTTCAGGGGTGATGGGATCATTCTTCTTGTTCTCCGGCTACTTCACATCGAAGCATGGAATACCAAATTATTGGATCTTCATGCACTATATATCGCTGTTTAAGTATCCATTTGAAGGGTTTCTGATAAATGAGTTCTCAAATTCAGGCAAATGCTTGGAATACATGTTTGGGAAATGCATGGTTAATGCAGAAGATTTGCTTAGAGAAGAAGGATATAGAGAGGATGAAAAGTGGAGAAATGTGGTGATCATGGTGTGTTTCATCTTGCTTTACAGGTTCATTTCTTATGTCATTCTTAGGTTTAGATGCTGTCCTGGCATCAGCAGGTTCAAGGGAACACTTGTCTGA


Protein sequences

Name Description Sequence
POPTR_0005s06530.1 ABC-2 type transporter family protein (best arabidopsis hit)

MKKQGCEIEAIGISYKISTKKREHPFKIFTKKQEINEEPKQVTDLEEASLGAKHVLKDVFCKAKPWEILAIVGPSGAGKSSLLEILAGKLTPQNGTIFVNQNPIDKARFKKISGYVTQKDTLFPLLTVEETLMFSAKLRLRLPQAQLSSNVKSLMKELGLDHVAMTRVGDDRIRGISGGERRRVSIGVDAIHDPEVLILDEPTSGLDSTSALQIIDMLKVMAETRGRTIILSIHQPGFRIVKLFNSILMMANGSVLHHGTVDQLGVNLRTMGMQLPIHVNVVEFAIESIETIQQQREVLQKEMQPQVLTSSTTKPQQKKIEEVGEGRSGKFTLQQLFQQSKVVDEEIINVEFDFPLGFANSRLQETLILTHRFSKNIFRTKELFACRTIQMLISGLVLGSIFYNLEDDLIGAEERVGLFAFILTFLLSCTTEALPIFLQEREILMKETSCGSYRVSSYAIANGLVYLPFLLILAILFTIPLYWLVGLNPNFIAFMHFLLLIWLILYTANSVVVCFSALVPNFIVGNSVISGVMGSFFLFSGYFTSKHGIPNYWIFMHYISLFKYPFEGFLINEFSNSGKCLEYMFGKCMVNAEDLLREEGYREDEKWRNVVIMVCFILLYRFISYVILRFRCCPGISRFKGTLV*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
1-644 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

MKKQGCEIEAIGISYKISTKKREHPFKIFTKKQEINEEPKQVTDLEEASLGAKHVLKDVFCKAKPWEILAIVGPSGAGKSSLLEILAGKLTPQNGTIFVNQNPIDKARFKKISGYVTQKDTLFPLLTVEETLMFSAKLRLRLPQAQLSSNVKSLMKELGLDHVAMTRVGDDRIRGISGGERRRVSIGVDAIHDPEVLILDEPTSGLDSTSALQIIDMLKVMAETRGRTIILSIHQPGFRIVKLFNSILMMANGSVLHHGTVDQLGVNLRTMGMQLPIHVNVVEFAIESIETIQQQREVLQKEMQPQVLTSSTTKPQQKKIEEVGEGRSGKFTLQQLFQQSKVVDEEIINVEFDFPLGFANSRLQETLILTHRFSKNIFRTKELFACRTIQMLISGLVLGSIFYNLEDDLIGAEERVGLFAFILTFLLSCTTEALPIFLQEREILMKETSCGSYRVSSYAIANGLVYLPFLLILAILFTIPLYWLVGLNPNFIAFMHFLLLIWLILYTANSVVVCFSALVPNFIVGNSVISGVMGSFFLFSGYFTSKHGIPNYWIFMHYISLFKYPFEGFLINEFSNSGKCLEYMFGKCMVNAEDLLREEGYREDEKWRNVVIMVCFILLYRFISYVILRFRCCPGISRFKGTLV

HMMPanther: PTHR19241:SF101
1-644 SUBFAMILY NOT NAMED

MKKQGCEIEAIGISYKISTKKREHPFKIFTKKQEINEEPKQVTDLEEASLGAKHVLKDVFCKAKPWEILAIVGPSGAGKSSLLEILAGKLTPQNGTIFVNQNPIDKARFKKISGYVTQKDTLFPLLTVEETLMFSAKLRLRLPQAQLSSNVKSLMKELGLDHVAMTRVGDDRIRGISGGERRRVSIGVDAIHDPEVLILDEPTSGLDSTSALQIIDMLKVMAETRGRTIILSIHQPGFRIVKLFNSILMMANGSVLHHGTVDQLGVNLRTMGMQLPIHVNVVEFAIESIETIQQQREVLQKEMQPQVLTSSTTKPQQKKIEEVGEGRSGKFTLQQLFQQSKVVDEEIINVEFDFPLGFANSRLQETLILTHRFSKNIFRTKELFACRTIQMLISGLVLGSIFYNLEDDLIGAEERVGLFAFILTFLLSCTTEALPIFLQEREILMKETSCGSYRVSSYAIANGLVYLPFLLILAILFTIPLYWLVGLNPNFIAFMHFLLLIWLILYTANSVVVCFSALVPNFIVGNSVISGVMGSFFLFSGYFTSKHGIPNYWIFMHYISLFKYPFEGFLINEFSNSGKCLEYMFGKCMVNAEDLLREEGYREDEKWRNVVIMVCFILLYRFISYVILRFRCCPGISRFKGTLV

ProfileScan: PS50893
IPR003439
40-277 ABC_TRANSPORTER_2
ABC transporter-like

KQVTDLEEASLGAKHVLKDVFCKAKPWEILAIVGPSGAGKSSLLEILAGKLTPQNGTIFVNQNPIDKARFKKISGYVTQKDTLFPLLTVEETLMFSAKLRLRLPQAQLSSNVKSLMKELGLDHVAMTRVGDDRIRGISGGERRRVSIGVDAIHDPEVLILDEPTSGLDSTSALQIIDMLKVMAETRGRTIILSIHQPGFRIVKLFNSILMMANGSVLHHGTVDQLGVNLRTMGMQLPI

superfamily: SSF52540
45-259 P-loop containing nucleoside triphosphate hydrolases

LEEASLGAKHVLKDVFCKAKPWEILAIVGPSGAGKSSLLEILAGKLTPQNGTIFVNQNPIDKARFKKISGYVTQKDTLFPLLTVEETLMFSAKLRLRLPQAQLSSNVKSLMKELGLDHVAMTRVGDDRIRGISGGERRRVSIGVDAIHDPEVLILDEPTSGLDSTSALQIIDMLKVMAETRGRTIILSIHQPGFRIVKLFNSILMMANGSVLHHG

Gene3D: G3DSA:3.40.50.300
49-264 no description

SLGAKHVLKDVFCKAKPWEILAIVGPSGAGKSSLLEILAGKLTPQNGTIFVNQNPIDKARFKKISGYVTQKDTLFPLLTVEETLMFSAKLRLRLPQAQLSSNVKSLMKELGLDHVAMTRVGDDRIRGISGGERRRVSIGVDAIHDPEVLILDEPTSGLDSTSALQIIDMLKVMAETRGRTIILSIHQPGFRIVKLFNSILMMANGSVLHHGTVDQL

HMMSmart: SM00382
IPR003593
65-254 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PWEILAIVGPSGAGKSSLLEILAGKLTPQNGTIFVNQNPIDKARFKKISGYVTQKDTLFPLLTVEETLMFSAKLRLRLPQAQLSSNVKSLMKELGLDHVAMTRVGDDRIRGISGGERRRVSIGVDAIHDPEVLILDEPTSGLDSTSALQIIDMLKVMAETRGRTIILSIHQPGFRIVKLFNSILMMANGS

HMMPfam: PF00005
IPR003439
80-204 ABC_tran
ABC transporter-like

SSLLEILAGKLTPQNGTIFVNQNPIDKARFKKISGYVTQKDTLFPLLTVEETLMFSAKLRLRLPQAQLSSNVKSLMKELGLDHVAMTRVGDDRIRGISGGERRRVSIGVDAIHDPEVLILDEPTS

Seg: seg
167-188 seg

RVGDDRIRGISGGERRRVSIGV

PatternScan: PS00211
IPR017871
176-190 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGERRRVSIGVDA

Coil: coil
282-303 coiled-coil

VEFAIESIETIQQQREVLQKEM

HMMPfam: PF01061
IPR013525
366-574 ABC2_membrane
ABC-2 type transporter

TLILTHRFSKNIFRTKELFACRTIQMLISGLVLGSIFYNLEDDLIGAEERVGLFAFILTFLLSCTTEALPIFLQEREILMKETSCGSYRVSSYAIANGLVYLPFLLILAILFTIPLYWLVGLNPNFIAFMHFLLLIWLILYTANSVVVCFSALVPNFIVGNSVISGVMGSFFLFSGYFTSKHGIPNYWIFMHYISLFKYPFEGFLINEF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox