PRGDB00181459 (Si027388m)

From PRG Wiki
Jump to: navigation, search
Si027388m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit); stripe rust resistance protein Yr10, putative (best rice hit)

DNA Sequence

ATGGAGGTGGTGATGGGGGTAATGTCGAGGCTCATCCTCAAGATTGGGGATCTGCTCGTCAGCGAGTACAAGCTGCAGAAGGAGGTGAAGGGGGAGATCATGTTCCTCCAACCTCAGCTCGAGAGCATGCAGGGCGCCCTCAAGGAGATAACCAAGGTTCCGTCAGACCATATTGACACCCAGGACAAGGCCTGGGCCAGCGATGTGCAAGAGCTCTGCTATGACATAGAGGACAACATCGACACATTCATGGTGCGCGGCATGGGCATTGAGCCTGCAGGGCCGGATGGCATGAGGGGGTTCATTAGCAGGAGCCTTGATTTGCTGACAAGGCTCCGGATTCGCCGCAAGGCAATAGAGCTCGTTGGCATTGATGAGGCAAGGGATGAGCTGATTAACATTCTGGTGGAAGGGGATGGTGTGTCCAGCCAGCATGGCAAGGTAGTTTCCATAGTTGGATTTGGGGGGCTGGGAAAGACGACTCTTGCTAATGTGGTGTATGAAAAGATCAAGGAAAAATTCGATTGCTGGGCTTTTGTTACCGTGTCTCAAAATCCTGACACGAGGAAATTCTGCAAGGGGTTTCTCTATGAACTTGGAAAGAACATCAATGATGAAACATTGGATGAGAGGCAGCTCATCGATCAAACCAGAAAACTCCTTCAGATGAAGAGGTATGAAGAAATTGCACAACATTTACACTCCGTCAATTTCACAATACTACTATACTATAATCGTACTGCATTGTTACTCTGCATTGTTACTGATGACATATGGAGTGTCTCGATTTGGGATATGATTAGATGTGCTTTCCCCAATGATGTTGGTGGATACATAATTATCACAACTACCTGTATTTTAAAGGTAGCCGAACGAGTTGGTGGTGCTTACATGATGAAACCCCTTTGTCTTGAGAGCTCCAGAAAATTACTATACAGAAGAATATTTGGCAATGAAGAGAAATACAAATGTCTTGATGAGCACTTAACAGAAGTATCTGATAGAATTTTAAAGAAATGTGCAGGTGTACCATTAGCCATCATTACCATAGCTAGTTTGTTTGCTAATAGAGCTAGAGATACAATGGACTGGTATGAGGTGTGCAACTTTATTGGTACTGGATTGGAGTATGGTCTAGATGTAGAGAATATGAGGAAGATTTTGGCATATAGCTATTATGATTTGCCACCTCATCTATGGACTTGCTTACCATATTTAAGTGTATTTCCTGAAGATTCTGCAATTGAAAAATTTCGGCTGATATGGATGTGGATAGCTGAAGGTTTTTTACAACATGAACAAAAAGGGAAAGGCCTATATGAACTTGGAGAATATTATTTTAATGAGCTCATAAACAAAAGTTTGATCCAACCAGTGTATGACATGTATGAAGCCACAATAGAATCCTGCCGTGTACATGATATGGTCCTTGACCTCGTACTTTCCATTTCAAGTGAAGAAAATTTTGTTTGTAGATTATTGCTTCAGAGCAACACTGGTCAAGCTATTCCTTGTGCTCGTATGAACATGCTACAAGTGAGGTCAGTTGTTGCCTTTTCACTAGCTTTTAATCTAATGCCAGCCCTTGGGACATTCAGAGTTTTGCGTGTATTGGATTTAAAAAGCTGTTATCTTTCACAAGGTTGTGATCTTAAGCATCTCGGAAATCTATTTCACTTAAGGTACTTGGGAATAGGAAGCACATATCGTGCTCAGCTCCCTGATGATGTAGGAAACCTGCGATATCTACAGACATTAGATGTAGTGGGAAGTCTTTTTTTAAGTTTGCCATCAACAATTGTTCAGCTAAGAGATTTGATGTGTCTACGTGTCGACCAGAGTACAAGAGTGCCAAACGGGATTGGGAGCCTAACATCCCTTGAAGAGCTCTCAACCCTTTACATATGTGATGACTCCATGAATATTTTAGAAGAGCTATGCCATCTGACCGAACTCAGGGTGCTAGGCATTTTCTTGTTCCCTACAGAGAATGTAACCTTGGGGAAATCTCTGGTGATGTCCCTATGCAAGTTGCAAAAAGTCCAGAGTCTGACTATCTGGGCCACTGGTGGTGAATGCAACTTCGATGCATGGGACCTCTTCTCCCTACGGATCTCTGTGAGGGAGCTACATCATCTTGAAATTCTTGGAAAGTTGCCAGCCCTTCGTTATTTGTATCTGATGGTGGACCATGAGAACCTCAAAATCCCTCAGAGATTCATCATTTGTACTAGTTCATTCCCATGCCTTGTGCGATGCATGGTGTTGGGATTTTTAGGAGCAGTGGTGTTTCAGCAAGGAGCTATGATAAGGCTTGAAAGCCTTGCATTCACATTCCATGCATGGGAGTTGAGAGAAATTACGAGCAGTGATGGTAGATTGAACTTGGGCTTGGAGAACCTGCTGTCACTCCAGGATGTCCTG


Protein sequences

Name Description Sequence
Si027388m Disease resistance protein (CC-NBS-LRR class) family (best arabidopsis hit); stripe rust resistance protein Yr10, putative (best rice hit)

MEVVMGVMSRLILKIGDLLVSEYKLQKEVKGEIMFLQPQLESMQGALKEITKVPSDHIDTQDKAWASDVQELCYDIEDNIDTFMVRGMGIEPAGPDGMRGFISRSLDLLTRLRIRRKAIELVGIDEARDELINILVEGDGVSSQHGKVVSIVGFGGLGKTTLANVVYEKIKEKFDCWAFVTVSQNPDTRKFCKGFLYELGKNINDETLDERQLIDQTRKLLQMKRYEEIAQHLHSVNFTILLYYNRTALLLCIVTDDIWSVSIWDMIRCAFPNDVGGYIIITTTCILKVAERVGGAYMMKPLCLESSRKLLYRRIFGNEEKYKCLDEHLTEVSDRILKKCAGVPLAIITIASLFANRARDTMDWYEVCNFIGTGLEYGLDVENMRKILAYSYYDLPPHLWTCLPYLSVFPEDSAIEKFRLIWMWIAEGFLQHEQKGKGLYELGEYYFNELINKSLIQPVYDMYEATIESCRVHDMVLDLVLSISSEENFVCRLLLQSNTGQAIPCARMNMLQVRSVVAFSLAFNLMPALGTFRVLRVLDLKSCYLSQGCDLKHLGNLFHLRYLGIGSTYRAQLPDDVGNLRYLQTLDVVGSLFLSLPSTIVQLRDLMCLRVDQSTRVPNGIGSLTSLEELSTLYICDDSMNILEELCHLTELRVLGIFLFPTENVTLGKSLVMSLCKLQKVQSLTIWATGGECNFDAWDLFSLRISVRELHHLEILGKLPALRYLYLMVDHENLKIPQRFIICTSSFPCLVRCMVLGFLGAVVFQQGAMIRLESLAFTFHAWELREITSSDGRLNLGLENLLSLQDVL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
1-660 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

MEVVMGVMSRLILKIGDLLVSEYKLQKEVKGEIMFLQPQLESMQGALKEITKVPSDHIDTQDKAWASDVQELCYDIEDNIDTFMVRGMGIEPAGPDGMRGFISRSLDLLTRLRIRRKAIELVGIDEARDELINILVEGDGVSSQHGKVVSIVGFGGLGKTTLANVVYEKIKEKFDCWAFVTVSQNPDTRKFCKGFLYELGKNINDETLDERQLIDQTRKLLQMKRYEEIAQHLHSVNFTILLYYNRTALLLCIVTDDIWSVSIWDMIRCAFPNDVGGYIIITTTCILKVAERVGGAYMMKPLCLESSRKLLYRRIFGNEEKYKCLDEHLTEVSDRILKKCAGVPLAIITIASLFANRARDTMDWYEVCNFIGTGLEYGLDVENMRKILAYSYYDLPPHLWTCLPYLSVFPEDSAIEKFRLIWMWIAEGFLQHEQKGKGLYELGEYYFNELINKSLIQPVYDMYEATIESCRVHDMVLDLVLSISSEENFVCRLLLQSNTGQAIPCARMNMLQVRSVVAFSLAFNLMPALGTFRVLRVLDLKSCYLSQGCDLKHLGNLFHLRYLGIGSTYRAQLPDDVGNLRYLQTLDVVGSLFLSLPSTIVQLRDLMCLRVDQSTRVPNGIGSLTSLEELSTLYICDDSMNILEELCHLTELRVLGIFLF

HMMPanther: PTHR11017
1-660 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MEVVMGVMSRLILKIGDLLVSEYKLQKEVKGEIMFLQPQLESMQGALKEITKVPSDHIDTQDKAWASDVQELCYDIEDNIDTFMVRGMGIEPAGPDGMRGFISRSLDLLTRLRIRRKAIELVGIDEARDELINILVEGDGVSSQHGKVVSIVGFGGLGKTTLANVVYEKIKEKFDCWAFVTVSQNPDTRKFCKGFLYELGKNINDETLDERQLIDQTRKLLQMKRYEEIAQHLHSVNFTILLYYNRTALLLCIVTDDIWSVSIWDMIRCAFPNDVGGYIIITTTCILKVAERVGGAYMMKPLCLESSRKLLYRRIFGNEEKYKCLDEHLTEVSDRILKKCAGVPLAIITIASLFANRARDTMDWYEVCNFIGTGLEYGLDVENMRKILAYSYYDLPPHLWTCLPYLSVFPEDSAIEKFRLIWMWIAEGFLQHEQKGKGLYELGEYYFNELINKSLIQPVYDMYEATIESCRVHDMVLDLVLSISSEENFVCRLLLQSNTGQAIPCARMNMLQVRSVVAFSLAFNLMPALGTFRVLRVLDLKSCYLSQGCDLKHLGNLFHLRYLGIGSTYRAQLPDDVGNLRYLQTLDVVGSLFLSLPSTIVQLRDLMCLRVDQSTRVPNGIGSLTSLEELSTLYICDDSMNILEELCHLTELRVLGIFLF

superfamily: SSF52540
101-364 P-loop containing nucleoside triphosphate hydrolases

FISRSLDLLTRLRIRRKAIELVGIDEARDELINILVEGDGVSSQHGKVVSIVGFGGLGKTTLANVVYEKIKEKFDCWAFVTVSQNPDTRKFCKGFLYELGKNINDETLDERQLIDQTRKLLQMKRYEEIAQHLHSVNFTILLYYNRTALLLCIVTDDIWSVSIWDMIRCAFPNDVGGYIIITTTCILKVAERVGGAYMMKPLCLESSRKLLYRRIFGNEEKYKCLDEHLTEVSDRILKKCAGVPLAIITIASLFANRARDTMDW

Gene3D: G3DSA:3.40.50.300
122-205 no description

VGIDEARDELINILVEGDGVSSQHGKVVSIVGFGGLGKTTLANVVYEKIKEKFDCWAFVTVSQNPDTRKFCKGFLYELGKNIND

HMMPfam: PF00931
IPR002182
129-434 NB-ARC,NBS
NB-ARC

DELINILVEGDGVSSQHGKVVSIVGFGGLGKTTLANVVYEKIKEKFDCWAFVTVSQNPDTRKFCKGFLYELGKNINDETLDERQLIDQTRKLLQMKRYEEIAQHLHSVNFTILLYYNRTALLLCIVTDDIWSVSIWDMIRCAFPNDVGGYIIITTTCILKVAERVGGAYMMKPLCLESSRKLLYRRIFGNEEKYKCLDEHLTEVSDRILKKCAGVPLAIITIASLFANRARDTMDWYEVCNFIGTGLEYGLDVENMRKILAYSYYDLPPHLWTCLPYLSVFPEDSAIEKFRLIWMWIAEGFLQHEQ

FPrintScan: PR00364
IPR000767
148-163 DISEASERSIST
Disease resistance protein

VVSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
340-354 DISEASERSIST
Disease resistance protein

CAGVPLAIITIASLF

superfamily: SSF52058
471-727 L domain-like,LRR

RVHDMVLDLVLSISSEENFVCRLLLQSNTGQAIPCARMNMLQVRSVVAFSLAFNLMPALGTFRVLRVLDLKSCYLSQGCDLKHLGNLFHLRYLGIGSTYRAQLPDDVGNLRYLQTLDVVGSLFLSLPSTIVQLRDLMCLRVDQSTRVPNGIGSLTSLEELSTLYICDDSMNILEELCHLTELRVLGIFLFPTENVTLGKSLVMSLCKLQKVQSLTIWATGGECNFDAWDLFSLRISVRELHHLEILGKLPALRYLYL

FPrintScan: PR00364
IPR000767
530-546 DISEASERSIST
Disease resistance protein

GTFRVLRVLDLKSCYLS

Seg: seg
623-633 seg

SLTSLEELSTL

Gene3D: G3DSA:3.80.10.10
702-727 no description

SLRISVRELHHLEILGKLPALRYLYL

Seg: seg
794-804 seg

LNLGLENLLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox