PRGDB00181461 (Si027801m)

From PRG Wiki
Jump to: navigation, search
Si027801m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Setaria italica

Comment?

cysteine-rich RLK (RECEPTOR-like protein kinase) 40 (best arabidopsis hit); cysteine-rich receptor-like protein kinase 32 precursor, putative (best rice hit)

DNA Sequence

ATGACAGGTGCTACGCAGTTCAGTTTATCTCAATTGAAGGCCGCTACAAATGACTTTTCAGGTGACAATGTGGTTGGAAGTGGTGGCTTTAGTGTCGTCTACAAGGGTGTATTGCGCAACGGACTAGATGTTGCAATCAAGAAATTGTTAATCTCTGATGATTTTCCAGAGAGGCGCGTGCATCATGAGCTTAATGTTGGTGCAAAGCTTCAGCACAAAAACATAGTTAAACTTCTGGGATATTGCTTCGATAACAAAGAGGACGAAAGGCTATACCTTTTGGTCCAAGAATACATGCCCAATGGGAGCTTGGGAAGGGTTATTAATGCCTCTCGACTTGATTGGCCCTCCTGTTTCAAGATAATTCAGGGGATAGCACAGGGCCTACATTACCTACATGAGCAACACGTTCTCTATATGGATTTGAAACCAGCCAACATCCTCTTTGATTCAAAAATGAATCCTGTGATCATTGATTTTGGATTATCTATAGTCCTTGATGATGATGATGATGAGATCACTTGTGATTCCATAGCAGGCACAATGGGATATATTGCTCCAGAAAAAATTACAGGAGCTAAGATATCGATGAAGTCTGATGTGTTCTCTTTTGGAGTTATCCTCATTGAGATCATTACCGGGAGGAGAGTTACACCTTCCTGTGATCTACCGGCTTTGAGTTCAATTGAGATGATCAGGGCAATGAAAGGGTTATTTGATCCGGCACAGGTTAAGGACTCTCAGGTAATGGAGATAAACAAGTGCATGAAGCTAGGATTGATGTGCACG


Protein sequences

Name Description Sequence
Si027801m cysteine-rich RLK (RECEPTOR-like protein kinase) 40 (best arabidopsis hit); cysteine-rich receptor-like protein kinase 32 precursor, putative (best rice hit)

MTGATQFSLSQLKAATNDFSGDNVVGSGGFSVVYKGVLRNGLDVAIKKLLISDDFPERRVHHELNVGAKLQHKNIVKLLGYCFDNKEDERLYLLVQEYMPNGSLGRVINASRLDWPSCFKIIQGIAQGLHYLHEQHVLYMDLKPANILFDSKMNPVIIDFGLSIVLDDDDDEITCDSIAGTMGYIAPEKITGAKISMKSDVFSFGVILIEIITGRRVTPSCDLPALSSIEMIRAMKGLFDPAQVKDSQVMEINKCMKLGLMCT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-263 FAMILY NOT NAMED,FAMILY NOT NAMED

MTGATQFSLSQLKAATNDFSGDNVVGSGGFSVVYKGVLRNGLDVAIKKLLISDDFPERRVHHELNVGAKLQHKNIVKLLGYCFDNKEDERLYLLVQEYMPNGSLGRVINASRLDWPSCFKIIQGIAQGLHYLHEQHVLYMDLKPANILFDSKMNPVIIDFGLSIVLDDDDDEITCDSIAGTMGYIAPEKITGAKISMKSDVFSFGVILIEIITGRRVTPSCDLPALSSIEMIRAMKGLFDPAQVKDSQVMEINKCMKLGLMCT

Gene3D: G3DSA:3.30.200.20
3-82 no description

GATQFSLSQLKAATNDFSGDNVVGSGGFSVVYKGVLRNGLDVAIKKLLISDDFPERRVHHELNVGAKLQHKNIVKLLGYC

superfamily: SSF56112
IPR011009
5-222 Protein kinase-like (PK-like)
Protein kinase-like domain

TQFSLSQLKAATNDFSGDNVVGSGGFSVVYKGVLRNGLDVAIKKLLISDDFPERRVHHELNVGAKLQHKNIVKLLGYCFDNKEDERLYLLVQEYMPNGSLGRVINASRLDWPSCFKIIQGIAQGLHYLHEQHVLYMDLKPANILFDSKMNPVIIDFGLSIVLDDDDDEITCDSIAGTMGYIAPEKITGAKISMKSDVFSFGVILIEIITGRRVTPSCD

HMMSmart: SM00220
IPR002290
19-250 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSGDNVVGSGGFSVVYKGVLRNGLDVAIKKLLISDDFPERRVHHELNVGAKLQHKNIVKLLGYCFDNKEDERLYLLVQEYMPNGSLGRVINASRLDWPSCFKIIQGIAQGLHYLHEQHVLYMDLKPANILFDSKMNPVIIDFGLSIVLDDDDDEITCDSIAGTMGYIAPEKITGAKISMKSDVFSFGVILIEIITGRRVTPSCDLPALSSIEMIRAMKGLFDPAQVKDSQVM

ProfileScan: PS50011
IPR000719
19-263 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSGDNVVGSGGFSVVYKGVLRNGLDVAIKKLLISDDFPERRVHHELNVGAKLQHKNIVKLLGYCFDNKEDERLYLLVQEYMPNGSLGRVINASRLDWPSCFKIIQGIAQGLHYLHEQHVLYMDLKPANILFDSKMNPVIIDFGLSIVLDDDDDEITCDSIAGTMGYIAPEKITGAKISMKSDVFSFGVILIEIITGRRVTPSCDLPALSSIEMIRAMKGLFDPAQVKDSQVMEINKCMKLGLMCT

HMMSmart: SM00219
IPR020635
19-261 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSGDNVVGSGGFSVVYKGVLRNGLDVAIKKLLISDDFPERRVHHELNVGAKLQHKNIVKLLGYCFDNKEDERLYLLVQEYMPNGSLGRVINASRLDWPSCFKIIQGIAQGLHYLHEQHVLYMDLKPANILFDSKMNPVIIDFGLSIVLDDDDDEITCDSIAGTMGYIAPEKITGAKISMKSDVFSFGVILIEIITGRRVTPSCDLPALSSIEMIRAMKGLFDPAQVKDSQVMEINKCMKLGLM

HMMPfam: PF00069
IPR000719
23-235 Pkinase,Ser-thr
Protein kinase, catalytic domain

NVVGSGGFSVVYKGVLRNGLDVAIKKLLISDDFPERRVHHELNVGAKLQHKNIVKLLGYCFDNKEDERLYLLVQEYMPNGSLGRVINASRLDWPSCFKIIQGIAQGLHYLHEQHVLYMDLKPANILFDSKMNPVIIDFGLSIVLDDDDDEITCDSIAGTMGYIAPEKITGAKISMKSDVFSFGVILIEIITGRRVTPSCDLPALSSIEMIRAM

PatternScan: PS00107
IPR017441
25-48 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGSGGFSVVYKGVLRNGLDVAIKK

Gene3D: G3DSA:1.10.510.10
83-248 no description

FDNKEDERLYLLVQEYMPNGSLGRVINASRLDWPSCFKIIQGIAQGLHYLHEQHVLYMDLKPANILFDSKMNPVIIDFGLSIVLDDDDDEITCDSIAGTMGYIAPEKITGAKISMKSDVFSFGVILIEIITGRRVTPSCDLPALSSIEMIRAMKGLFDPAQVKDSQ

PatternScan: PS00108
IPR008271
137-149 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLYMDLKPANILF

Seg: seg
167-171 seg

DDDDD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox