PRGDB00181462 (Si025947m)

From PRG Wiki
Jump to: navigation, search
Si025947m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit); disease resistance protein RPM1, putative (best rice hit)

DNA Sequence

ATGGCTGAAGCAGTTGTAGGGTTGCTGATTGGCAAGCTCGGTGCAGCTTTGGTGAAAGAGGCAGCAAGTTCTGGTGCATCACTGATCTGCCACGAAGCCTCTGCCCTCAAGGGTCTCTTTGGTGAGATCCATGAAGCCAAGGATGAGCTTGAGAGTATGCAGGCTTACTTGAAAACAGCAGAGCGGTTCAAGGACACTGATGAGACCACCGGCCTCTTCGTCGACAGAATCAGGGGCTTCGCTTTTGAGATCGAGGATGTTGTTGATGAGTTCACCTACAAGCTGGAGGACAAGCACGGAGGGTTTGTTTCCAAGATGAAGAAGAGGATCAAGTATGCCAGTACCTGGCGCCGGCTTGCGCACAAGCTGAATGATATCAAGGGCAGGCTTCAAGGGGCTAAGCAGCGGAACCAGGACTACACCATGAAACAAACGGATAGAAATGCTGGAGGCATTGCTTTTCATGCCAATCAAGCTTTGAATTTCACAAGGGATGAGGACCTTGTGGGGATTACCGAGCACAAGAAGCAACTGGTTCAATGGCTAGCAGGTGATTTAGAACAGAGATGCAAAATATTCGCTGTTTGGGGCATGCCTGGTGTGGGGAAAACAACTTTGGTTGCTCATGTGTACAAGACCATCAAAATGGACTTTGATGCTGCTGCATGGGTAACCGTGTCACAGAGTTATGATGTTCAAGAGGTGTTGAAGAAAATTGCTGGAGAGTTTGGCATCACAGCTGATGGTGCCAACATGGAAATGGAAAGACTAGCTCCGACCATCTATGAGTACCTAAAAGGTAAAAGGTACATCTTAGTTCTGGATGACATTTGGACTGCAGATGTCTGGTCAGAGATAAGGACTGTTTTCCCATCTAATTGTATTGGTCGATTTGTTATCACATCAAGAAAGCATGAAGTATCATTATTAGGAACCAGTAATTCAGCTATTCACTTGGAACCACTTGGCAAAGATGACTCTTGGGAGTTATTCTGCAAATCAGCCTTTTGGAACGATGGTGACAGAAAGTGCCCATTGCACTTGAAGGTTTTGGCTTTGAAATTTGTCGACAAGTGTGAAGGGTTGCCTATTGCTATTGCATGCATCGGCAGCCAACTATCTGCGAAAGGACAAACTTCTGCCGAATGGGAAAAAGCATATGATGAGTTAGAGCTGCAGTTGGTTAAAAATGTGATGCCTCGTGTTGAGACTATTCTTAAAGTCAGCTTGGAGGACCTTCCATGTGATTTGAAAAATTGTTTCTTACACTGTGCATTATTCCCAGAAGATTATCCCATCAAGAGGAGGACAGTAATGAGGCACTGGATTAGTAGTGGGTTCATCAAGAAGAAGGGGAACCAAACTTTGGAGGAAGTGGCGGAGGAGTACTTGACTGAGCTTGTGAACCGAAGCCTATTACAGGTAGTGAAGAGGAATTATACTGGGCGGTTGAAATGTTGTCAAATGCATGATGTAATACGGCTTGTTGCGCTCAAAAAAGCAGAGAAAGAATGCTTTGGTAAAGTGTATGATGGCTCTGGGGAATTTTCTGGAGGGCCCACACGTCGTATATCAATCCAGAGTAGAAACCTTGACCGAATTAGTCCATCAAATGCATCACATATCCGTTCACTTCATGTTTTTGAGAGGTATATCGATATTGATTTGCTGAGGCCCATCCTAACATCTTCGAATTTGCTGTCAACGTTGGATCTGAAAGGTGCTTGTATCAAGATGTTGCCTACTGAGGTATTCAACTTGTTTCATCTGCGGTATTTGGGCCTTAGATCTACTGCTATTGAAAGTCTACCTGAAACAATAGGAAGGTTGCAAAACTTGGAAGTGTTGGATGCTTGTAATGCTCCGTTGTTGTATTTGCCAAATAACATTGTAAAACTTCAGAAGTTGAGATACCTTTATGCATGTAATGTTTATCGTGAAGGTGAAGATATTCGCCGTCGCAGTGGTGTAAAGGTGCCTAGTGGCATAAGGCACTTGATGTCACTGCAAGCTTTGCAATGTGTGGAGGCAAGTCCAGAAATTCTGCGTGAGGTTGGATATTTGACAGAGCTAAGAACATTCAGTGTCTGCAATGTGAGAAGTGAACACTCTGGTAACTTAAGAGATGCTGTCAACAAAATGAGTCATCTTGTTCATCTAGAAATTATAACTCTAGGGGAGAAGGAAGTGCTGCATCTAGAGGGACTTTGTTTACCTCCAACCTTTTCTTGGCTTTGTTTACAAGGACAGCTGGAGAGAAAATCAATACCGAAGGTTCTGTCATCTTGGTCTCGCCTCAGTAGTCTCACAAAGTTGGAGATGGAATTCTGCAGAATTGATGAGGAGTCGTTTCCCAGTTTGTTGGTGCTACGTGGTTTATGTCTCCTTAGCCTTACCAAGGCTTTTGATGGGAAGAAGCTGCACTTCACTGCAGGGTGTTTCCCAAGACTTCAAGTTCTATATATATGGCACGCACCACAGCTCAATCAAGTTCAAATAGAACAGGGTGCGATGTCAAACCTTGCTGAGCTCAACTTTGGTGACTGTCCTATGTTGAAGTATCTTCCTCAAGGTATTGAACACCTTAAAAACCTTGTGCAGTTATTACTGAAGGATACATCAGAAGAGCTCGTAGAGAGGCTTTGGCGGAAGGGAGGACCAGATGAATGCAAGGACGATAGTATGGACATTAGCCACATCAGAAAGGTTTTTGTTCTTATGGGCACCCGGGGATGGATAATGTGA


Protein sequences

Name Description Sequence
Si025947m NB-ARC domain-containing disease resistance protein (best arabidopsis hit); disease resistance protein RPM1, putative (best rice hit)

MAEAVVGLLIGKLGAALVKEAASSGASLICHEASALKGLFGEIHEAKDELESMQAYLKTAERFKDTDETTGLFVDRIRGFAFEIEDVVDEFTYKLEDKHGGFVSKMKKRIKYASTWRRLAHKLNDIKGRLQGAKQRNQDYTMKQTDRNAGGIAFHANQALNFTRDEDLVGITEHKKQLVQWLAGDLEQRCKIFAVWGMPGVGKTTLVAHVYKTIKMDFDAAAWVTVSQSYDVQEVLKKIAGEFGITADGANMEMERLAPTIYEYLKGKRYILVLDDIWTADVWSEIRTVFPSNCIGRFVITSRKHEVSLLGTSNSAIHLEPLGKDDSWELFCKSAFWNDGDRKCPLHLKVLALKFVDKCEGLPIAIACIGSQLSAKGQTSAEWEKAYDELELQLVKNVMPRVETILKVSLEDLPCDLKNCFLHCALFPEDYPIKRRTVMRHWISSGFIKKKGNQTLEEVAEEYLTELVNRSLLQVVKRNYTGRLKCCQMHDVIRLVALKKAEKECFGKVYDGSGEFSGGPTRRISIQSRNLDRISPSNASHIRSLHVFERYIDIDLLRPILTSSNLLSTLDLKGACIKMLPTEVFNLFHLRYLGLRSTAIESLPETIGRLQNLEVLDACNAPLLYLPNNIVKLQKLRYLYACNVYREGEDIRRRSGVKVPSGIRHLMSLQALQCVEASPEILREVGYLTELRTFSVCNVRSEHSGNLRDAVNKMSHLVHLEIITLGEKEVLHLEGLCLPPTFSWLCLQGQLERKSIPKVLSSWSRLSSLTKLEMEFCRIDEESFPSLLVLRGLCLLSLTKAFDGKKLHFTAGCFPRLQVLYIWHAPQLNQVQIEQGAMSNLAELNFGDCPMLKYLPQGIEHLKNLVQLLLKDTSEELVERLWRKGGPDECKDDSMDISHIRKVFVLMGTRGWIM*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
14-913 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GAALVKEAASSGASLICHEASALKGLFGEIHEAKDELESMQAYLKTAERFKDTDETTGLFVDRIRGFAFEIEDVVDEFTYKLEDKHGGFVSKMKKRIKYASTWRRLAHKLNDIKGRLQGAKQRNQDYTMKQTDRNAGGIAFHANQALNFTRDEDLVGITEHKKQLVQWLAGDLEQRCKIFAVWGMPGVGKTTLVAHVYKTIKMDFDAAAWVTVSQSYDVQEVLKKIAGEFGITADGANMEMERLAPTIYEYLKGKRYILVLDDIWTADVWSEIRTVFPSNCIGRFVITSRKHEVSLLGTSNSAIHLEPLGKDDSWELFCKSAFWNDGDRKCPLHLKVLALKFVDKCEGLPIAIACIGSQLSAKGQTSAEWEKAYDELELQLVKNVMPRVETILKVSLEDLPCDLKNCFLHCALFPEDYPIKRRTVMRHWISSGFIKKKGNQTLEEVAEEYLTELVNRSLLQVVKRNYTGRLKCCQMHDVIRLVALKKAEKECFGKVYDGSGEFSGGPTRRISIQSRNLDRISPSNASHIRSLHVFERYIDIDLLRPILTSSNLLSTLDLKGACIKMLPTEVFNLFHLRYLGLRSTAIESLPETIGRLQNLEVLDACNAPLLYLPNNIVKLQKLRYLYACNVYREGEDIRRRSGVKVPSGIRHLMSLQALQCVEASPEILREVGYLTELRTFSVCNVRSEHSGNLRDAVNKMSHLVHLEIITLGEKEVLHLEGLCLPPTFSWLCLQGQLERKSIPKVLSSWSRLSSLTKLEMEFCRIDEESFPSLLVLRGLCLLSLTKAFDGKKLHFTAGCFPRLQVLYIWHAPQLNQVQIEQGAMSNLAELNFGDCPMLKYLPQGIEHLKNLVQLLLKDTSEELVERLWRKGGPDECKDDSMDISHIRKVFVLMGTRGWI

HMMPanther: PTHR23155:SF125
14-913 PUTATIVE RPR1 (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01G0547000 PROTEIN),PUTATIVE RPR1 (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01G0547000 PROTEIN)

GAALVKEAASSGASLICHEASALKGLFGEIHEAKDELESMQAYLKTAERFKDTDETTGLFVDRIRGFAFEIEDVVDEFTYKLEDKHGGFVSKMKKRIKYASTWRRLAHKLNDIKGRLQGAKQRNQDYTMKQTDRNAGGIAFHANQALNFTRDEDLVGITEHKKQLVQWLAGDLEQRCKIFAVWGMPGVGKTTLVAHVYKTIKMDFDAAAWVTVSQSYDVQEVLKKIAGEFGITADGANMEMERLAPTIYEYLKGKRYILVLDDIWTADVWSEIRTVFPSNCIGRFVITSRKHEVSLLGTSNSAIHLEPLGKDDSWELFCKSAFWNDGDRKCPLHLKVLALKFVDKCEGLPIAIACIGSQLSAKGQTSAEWEKAYDELELQLVKNVMPRVETILKVSLEDLPCDLKNCFLHCALFPEDYPIKRRTVMRHWISSGFIKKKGNQTLEEVAEEYLTELVNRSLLQVVKRNYTGRLKCCQMHDVIRLVALKKAEKECFGKVYDGSGEFSGGPTRRISIQSRNLDRISPSNASHIRSLHVFERYIDIDLLRPILTSSNLLSTLDLKGACIKMLPTEVFNLFHLRYLGLRSTAIESLPETIGRLQNLEVLDACNAPLLYLPNNIVKLQKLRYLYACNVYREGEDIRRRSGVKVPSGIRHLMSLQALQCVEASPEILREVGYLTELRTFSVCNVRSEHSGNLRDAVNKMSHLVHLEIITLGEKEVLHLEGLCLPPTFSWLCLQGQLERKSIPKVLSSWSRLSSLTKLEMEFCRIDEESFPSLLVLRGLCLLSLTKAFDGKKLHFTAGCFPRLQVLYIWHAPQLNQVQIEQGAMSNLAELNFGDCPMLKYLPQGIEHLKNLVQLLLKDTSEELVERLWRKGGPDECKDDSMDISHIRKVFVLMGTRGWI

Coil: coil
123-144 coiled-coil

LNDIKGRLQGAKQRNQDYTMKQ

superfamily: SSF52540
151-398 P-loop containing nucleoside triphosphate hydrolases

GIAFHANQALNFTRDEDLVGITEHKKQLVQWLAGDLEQRCKIFAVWGMPGVGKTTLVAHVYKTIKMDFDAAAWVTVSQSYDVQEVLKKIAGEFGITADGANMEMERLAPTIYEYLKGKRYILVLDDIWTADVWSEIRTVFPSNCIGRFVITSRKHEVSLLGTSNSAIHLEPLGKDDSWELFCKSAFWNDGDRKCPLHLKVLALKFVDKCEGLPIAIACIGSQLSAKGQTSAEWEKAYDELELQLVKNV

Gene3D: G3DSA:3.40.50.300
170-290 no description

GITEHKKQLVQWLAGDLEQRCKIFAVWGMPGVGKTTLVAHVYKTIKMDFDAAAWVTVSQSYDVQEVLKKIAGEFGITADGANMEMERLAPTIYEYLKGKRYILVLDDIWTADVWSEIRTVF

HMMPfam: PF00931
IPR002182
172-450 NB-ARC,NBS
NB-ARC

TEHKKQLVQWLAGDLEQRCKIFAVWGMPGVGKTTLVAHVYKTIKMDFDAAAWVTVSQSYDVQEVLKKIAGEFGITADGANMEMERLAPTIYEYLKGKRYILVLDDIWTADVWSEIRTVFPSNCIGRFVITSRKHEVSLLGTSNSAIHLEPLGKDDSWELFCKSAFWNDGDRKCPLHLKVLALKFVDKCEGLPIAIACIGSQLSAKGQTSAEWEKAYDELELQLVKNVMPRVETILKVSLEDLPCDLKNCFLHCALFPEDYPIKRRTVMRHWISSGFIKK

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

IFAVWGMPGVGKTTLV

FPrintScan: PR00364
IPR000767
264-278 DISEASERSIST
Disease resistance protein

YLKGKRYILVLDDIW

FPrintScan: PR00364
IPR000767
359-373 DISEASERSIST
Disease resistance protein

CEGLPIAIACIGSQL

superfamily: SSF52058
488-872 L domain-like,LRR

QMHDVIRLVALKKAEKECFGKVYDGSGEFSGGPTRRISIQSRNLDRISPSNASHIRSLHVFERYIDIDLLRPILTSSNLLSTLDLKGACIKMLPTEVFNLFHLRYLGLRSTAIESLPETIGRLQNLEVLDACNAPLLYLPNNIVKLQKLRYLYACNVYREGEDIRRRSGVKVPSGIRHLMSLQALQCVEASPEILREVGYLTELRTFSVCNVRSEHSGNLRDAVNKMSHLVHLEIITLGEKEVLHLEGLCLPPTFSWLCLQGQLERKSIPKVLSSWSRLSSLTKLEMEFCRIDEESFPSLLVLRGLCLLSLTKAFDGKKLHFTAGCFPRLQVLYIWHAPQLNQVQIEQGAMSNLAELNFGDCPMLKYLPQGIEHLKNLVQLLLKD

Gene3D: G3DSA:3.80.10.10
538-668 no description

NASHIRSLHVFERYIDIDLLRPILTSSNLLSTLDLKGACIKMLPTEVFNLFHLRYLGLRSTAIESLPETIGRLQNLEVLDACNAPLLYLPNNIVKLQKLRYLYACNVYREGEDIRRRSGVKVPSGIRHLMS

Seg: seg
561-572 seg

LTSSNLLSTLDL

FPrintScan: PR00364
IPR000767
608-624 DISEASERSIST
Disease resistance protein

GRLQNLEVLDACNAPLL

Gene3D: G3DSA:3.80.10.10
669-873 no description

LQALQCVEASPEILREVGYLTELRTFSVCNVRSEHSGNLRDAVNKMSHLVHLEIITLGEKEVLHLEGLCLPPTFSWLCLQGQLERKSIPKVLSSWSRLSSLTKLEMEFCRIDEESFPSLLVLRGLCLLSLTKAFDGKKLHFTAGCFPRLQVLYIWHAPQLNQVQIEQGAMSNLAELNFGDCPMLKYLPQGIEHLKNLVQLLLKDT

Seg: seg
787-798 seg

LLVLRGLCLLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox