PRGDB00181463 (Si025844m)

From PRG Wiki
Jump to: navigation, search
Si025844m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Setaria italica

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit); conserved hypothetical protein (best rice hit)

DNA Sequence

ATGATAAACACACCCACGCACAGAAATAAGATGCCTCGCGTAACAATCTACAACGCCTCCTTCCTGCCACCGCTTTCTTTCATCTTCTTCAGCTTACTTGCCCTGTGTCCAAATTTGCACGCCTCATCTGGAACCTTCAATGAATCCGATGCCCTTCTCTGCCTCAAATCTCAGCTCCGCGACCCAGGAGGAGCACTAGCATCATGGAGAAACGACTCCCCTGCGTTCTGCGAGTGGCACGGGGTGACATGTGCCACTAAACAGAACGCATCCCGAGTCATCGCACTGGATCTTGAATCAGAGGACATTTCTGATAACATCTTCCCATGTGTTGCTAACCTCAGCTTCCTTGAAAGGATCCACATGCCCAATAATCAGCTCAATGGCCATATTTCTCCAGTCATCAGCCGATTAACCTGGCTTCAGTACCTCAACCTCAGCATGAACTCCCTTAGTGGTGAGATACCAGAGACAATATCTTCGTGTTCTCGCCTTGAGGCCATCGACCTTTATAGCAATGCGTTACAAGGTGAGATCCCTCCAGGTCTTAGTCAGTGTTTGTCTCTTAAAAGTATTATTCTTAGCAACAACAATCTTCGTGGGAGCATCCCTCCAGAACTTGGCTTGCTTCCCAATCTTTCTGCCCTGTTCCTCCCTAGCAATTATCTGACAGGCAACATTCCTGAGTTTTTGGGGAAGAGCAACTATCTGACGTGGGTAAATCTACAGAATAATAACCTTAGTGGAGGAATACCAGCCGCTCTATTCAACAGCACAACCCTTTCTTACATAGATCTCTCACAAAATAACCTTTCTGGGTCTATCCCGCCTTTCAGGCAGTGGCAGGCATCGTCCTCAGTACTGAAGTACCTTAGCTTAGATAAAAATATGCTCTCAGGAGAGATTCCTCACTCACTCGGTAACCTTGCTTCCTTATCTTCATTACTCCTTTCTCATAACAATTTACATGGACAGATCCCAGAGAGCTTCAGTAACCTTACAAGTTTGCAAACACTAAACCTCAATTACAACAACTTGTCAGGCACTGTTCCACCAGCACTTTATAACATCTCTTCTCTTATTTTTCTTGGCCTTGGTGCCAACCAACTCGTCGGGAGGCTTCCTGCCGACATTGGTAACACCCTTACAAGCATCACAAATTTGATATTGGAAGGGAACAAGTTTGAAGGGCCACTTCCTTCTTCCCTGGACAACGCCACAAACTTGCAAGTTCTAGACCTTCGTAGCAACACGTTCGCAGGTGTTATTCCTTCACTAGGATCCCTGTCCAAATTGAGTTACCTAGATCTGGGTGTTAACAGGCTTGAAGCTGGAGACTCGACTTTCTTATCCTCTCTAAAAAACAGCACCCAGTTACTCGAATTATGGTTGGATAGAAACCACCTTCAAGGAGTAATATCTGCTTATATTACCAATATTTCAAAAAGCTTAAAGGTCCTCGTGCTGATAGAAAATAAATTGACAGGACCTATACCATCAGAGATTGGAAATTTCATGAACCTCACTGTCCTTCAAGTAGATAACAACTTACTCTCAGGATATATTCCAGACATGCTTGGAAACCTCCGAAACTTGTCCATCCTAACCTTATCCTGCAACAAACTTTCTGGAGAAATACCACAATCAATTGGTAAATTGGATCAGCTTACTATGCTTAATTTTGGGGGAAATGATTTGACCGGACTCATACCTTCTAGCATAAATGGTTGTAAACATTTGACGACACTCAACCTTTCTTCCAATAGCTTATACGGAGCTATACCTGAGGAACTATTTTCAATATCTACGCTTTCTGAAGGCTTAGACCTGTCCTATAACCAACTCACTGGAGACATACCATTGGAGATTGGTAGATTAATTAATCTGAATTTACTAAATCTTTCCAACAATCAATTATCAGGTGAGATTCCCACCACACTTGGTCAGTGCCTTCTTTTGGATTCTCTCCACTTAGAGAAGAATTTCCTGAAAGGAAGCATCCCAAATTCTTTTATCAGCTTACAAGGCATCTCTGAGATGGATCTTTCCCAGAATAACTTGTCAGGTAGAATTCCTGAATATTTTGAGTCCTTCACCTTGTTACGTTTTCTAAATCTATCCTTCAATGACCTTGAGGGGGCCGTCCCTGGAGGTGGCGTGTTTGCCAATGCGAGTGACGTGTTCATCCAAGGAAACGGCAAACTCTGTGCAACTTCTCCAATTCTGCATGTACCACTCTGCAGGACATCAGCTCATAACAGGAAGAGTACAAAATATATTGTATCTGTAGTAGTTCCACTTTCTACTATGGTTGCAGTCATCGCGGCATGTGTTGCAGTCATTATTCTGAAGAAGAAAAGGCAAGCTAAGACGCTCACTGACCAATCACTCAAGCAGTTCAAGAACTTCTCATACACTGACTTATTCAAAGCAACAGATGGTTTCTCTCCAAATAATCTTGTTGGTTCAGGAAGATTTGGAATGGTATACAAAGGTCAGTTGAAGTTTGAATTATGTGCAGTAGCCATAAAGGTATTCAGGTCCGACCAACTTGGAGCACCAAGCAACTTCCTCTCTGAATGCGAGGCTCTAAGAAACACTCGCCATCGGAATCTTTTAAGAGTGATAAGTGTATGTTCAACCTTTGATCCAATAGGAACTGAATTCAAAGCGCTCATTCTTGAGTACATGGGTCATGGTAACCTAGAGGGCTGGCTCCATCCAGAAGAATACAGAAAGAGCACAAAAGGACCACTGAGTTTAGACTCACGGATAAAAATAGCTGTGGATGTTGCTGCTGCCCTAGATTATCTTCATAATCGATGTGCTCCTCCTTTGGTTCATTGTGATCTAAAGCCAAGCAATGTGCTTCTGAATGATGAAATGGTTGCATGCCTTGGTGACTTTGGGCTTGCAAAGTTTCTATCCAGTGACTCTTCAACGTCGAGCATTGCAGGACCCAGAGGATCTGTCGGATACATTGCACCAGAGTATGGCATGGGGTGCAAAGTTTCAATTGAGGGTGACATCTACAGCTATGGAATCATGCTTCTAGAGATGATCACAGGAAAGCGTCCAACCGATGAGATGTTTAAGGACGGTATAAACCTTCGCGGCTTCGTGAAGTCATCCCTTCCACTGAAAATAAATGAGATCTTAGAACCCAATCTCACCCGATATCTTGAAGGTGAAGACACAGATCAAGTAATGGGTGGGATCCAAAAGTGTGCTCTGCAGCTAGCTAATCTTGGCCTGGTATGCTCTGAGATGTCTCCCAAGGACCGGCCAACAACAGAGGATGTTTATGCTGAAATCTTATCCATTAAAGAAGAGTTTTCAGCTAAACTGGATACCAATTTAATTCATTAA


Protein sequences

Name Description Sequence
Si025844m Leucine-rich repeat protein kinase family protein (best arabidopsis hit); conserved hypothetical protein (best rice hit)

MINTPTHRNKMPRVTIYNASFLPPLSFIFFSLLALCPNLHASSGTFNESDALLCLKSQLRDPGGALASWRNDSPAFCEWHGVTCATKQNASRVIALDLESEDISDNIFPCVANLSFLERIHMPNNQLNGHISPVISRLTWLQYLNLSMNSLSGEIPETISSCSRLEAIDLYSNALQGEIPPGLSQCLSLKSIILSNNNLRGSIPPELGLLPNLSALFLPSNYLTGNIPEFLGKSNYLTWVNLQNNNLSGGIPAALFNSTTLSYIDLSQNNLSGSIPPFRQWQASSSVLKYLSLDKNMLSGEIPHSLGNLASLSSLLLSHNNLHGQIPESFSNLTSLQTLNLNYNNLSGTVPPALYNISSLIFLGLGANQLVGRLPADIGNTLTSITNLILEGNKFEGPLPSSLDNATNLQVLDLRSNTFAGVIPSLGSLSKLSYLDLGVNRLEAGDSTFLSSLKNSTQLLELWLDRNHLQGVISAYITNISKSLKVLVLIENKLTGPIPSEIGNFMNLTVLQVDNNLLSGYIPDMLGNLRNLSILTLSCNKLSGEIPQSIGKLDQLTMLNFGGNDLTGLIPSSINGCKHLTTLNLSSNSLYGAIPEELFSISTLSEGLDLSYNQLTGDIPLEIGRLINLNLLNLSNNQLSGEIPTTLGQCLLLDSLHLEKNFLKGSIPNSFISLQGISEMDLSQNNLSGRIPEYFESFTLLRFLNLSFNDLEGAVPGGGVFANASDVFIQGNGKLCATSPILHVPLCRTSAHNRKSTKYIVSVVVPLSTMVAVIAACVAVIILKKKRQAKTLTDQSLKQFKNFSYTDLFKATDGFSPNNLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALILEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDVYAEILSIKEEFSAKLDTNLIH*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
12-1115 FAMILY NOT NAMED,FAMILY NOT NAMED

PRVTIYNASFLPPLSFIFFSLLALCPNLHASSGTFNESDALLCLKSQLRDPGGALASWRNDSPAFCEWHGVTCATKQNASRVIALDLESEDISDNIFPCVANLSFLERIHMPNNQLNGHISPVISRLTWLQYLNLSMNSLSGEIPETISSCSRLEAIDLYSNALQGEIPPGLSQCLSLKSIILSNNNLRGSIPPELGLLPNLSALFLPSNYLTGNIPEFLGKSNYLTWVNLQNNNLSGGIPAALFNSTTLSYIDLSQNNLSGSIPPFRQWQASSSVLKYLSLDKNMLSGEIPHSLGNLASLSSLLLSHNNLHGQIPESFSNLTSLQTLNLNYNNLSGTVPPALYNISSLIFLGLGANQLVGRLPADIGNTLTSITNLILEGNKFEGPLPSSLDNATNLQVLDLRSNTFAGVIPSLGSLSKLSYLDLGVNRLEAGDSTFLSSLKNSTQLLELWLDRNHLQGVISAYITNISKSLKVLVLIENKLTGPIPSEIGNFMNLTVLQVDNNLLSGYIPDMLGNLRNLSILTLSCNKLSGEIPQSIGKLDQLTMLNFGGNDLTGLIPSSINGCKHLTTLNLSSNSLYGAIPEELFSISTLSEGLDLSYNQLTGDIPLEIGRLINLNLLNLSNNQLSGEIPTTLGQCLLLDSLHLEKNFLKGSIPNSFISLQGISEMDLSQNNLSGRIPEYFESFTLLRFLNLSFNDLEGAVPGGGVFANASDVFIQGNGKLCATSPILHVPLCRTSAHNRKSTKYIVSVVVPLSTMVAVIAACVAVIILKKKRQAKTLTDQSLKQFKNFSYTDLFKATDGFSPNNLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALILEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDVYAEILSIKEEFSAK

HMMPanther: PTHR24420:SF474
12-1115 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

PRVTIYNASFLPPLSFIFFSLLALCPNLHASSGTFNESDALLCLKSQLRDPGGALASWRNDSPAFCEWHGVTCATKQNASRVIALDLESEDISDNIFPCVANLSFLERIHMPNNQLNGHISPVISRLTWLQYLNLSMNSLSGEIPETISSCSRLEAIDLYSNALQGEIPPGLSQCLSLKSIILSNNNLRGSIPPELGLLPNLSALFLPSNYLTGNIPEFLGKSNYLTWVNLQNNNLSGGIPAALFNSTTLSYIDLSQNNLSGSIPPFRQWQASSSVLKYLSLDKNMLSGEIPHSLGNLASLSSLLLSHNNLHGQIPESFSNLTSLQTLNLNYNNLSGTVPPALYNISSLIFLGLGANQLVGRLPADIGNTLTSITNLILEGNKFEGPLPSSLDNATNLQVLDLRSNTFAGVIPSLGSLSKLSYLDLGVNRLEAGDSTFLSSLKNSTQLLELWLDRNHLQGVISAYITNISKSLKVLVLIENKLTGPIPSEIGNFMNLTVLQVDNNLLSGYIPDMLGNLRNLSILTLSCNKLSGEIPQSIGKLDQLTMLNFGGNDLTGLIPSSINGCKHLTTLNLSSNSLYGAIPEELFSISTLSEGLDLSYNQLTGDIPLEIGRLINLNLLNLSNNQLSGEIPTTLGQCLLLDSLHLEKNFLKGSIPNSFISLQGISEMDLSQNNLSGRIPEYFESFTLLRFLNLSFNDLEGAVPGGGVFANASDVFIQGNGKLCATSPILHVPLCRTSAHNRKSTKYIVSVVVPLSTMVAVIAACVAVIILKKKRQAKTLTDQSLKQFKNFSYTDLFKATDGFSPNNLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALILEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDVYAEILSIKEEFSAK

Seg: seg
19-35 seg

ASFLPPLSFIFFSLLAL

Gene3D: G3DSA:3.80.10.10
48-280 no description

ESDALLCLKSQLRDPGGALASWRNDSPAFCEWHGVTCATKQNASRVIALDLESEDISDNIFPCVANLSFLERIHMPNNQLNGHISPVISRLTWLQYLNLSMNSLSGEIPETISSCSRLEAIDLYSNALQGEIPPGLSQCLSLKSIILSNNNLRGSIPPELGLLPNLSALFLPSNYLTGNIPEFLGKSNYLTWVNLQNNNLSGGIPAALFNSTTLSYIDLSQNNLSGSIPPFRQ

HMMPfam: PF08263
IPR013210
48-84 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ESDALLCLKSQLRDPGGALASWRNDSPAFCEWHGVTC

superfamily: SSF52058
55-421 L domain-like,LRR

LKSQLRDPGGALASWRNDSPAFCEWHGVTCATKQNASRVIALDLESEDISDNIFPCVANLSFLERIHMPNNQLNGHISPVISRLTWLQYLNLSMNSLSGEIPETISSCSRLEAIDLYSNALQGEIPPGLSQCLSLKSIILSNNNLRGSIPPELGLLPNLSALFLPSNYLTGNIPEFLGKSNYLTWVNLQNNNLSGGIPAALFNSTTLSYIDLSQNNLSGSIPPFRQWQASSSVLKYLSLDKNMLSGEIPHSLGNLASLSSLLLSHNNLHGQIPESFSNLTSLQTLNLNYNNLSGTVPPALYNISSLIFLGLGANQLVGRLPADIGNTLTSITNLILEGNKFEGPLPSSLDNATNLQVLDLRSNTFAG

HMMSmart: SM00369
IPR003591
138-162 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTWLQYLNLSMNSLSGEIPETISSC

HMMPfam: PF13855
141-199 LRR_8,Leucine rich repeat

LQYLNLSMNSLSGEIPETISSCSRLEAIDLYSNALQGEIPPGLSQCLSLKSIILSNNNL

FPrintScan: PR00019
261-274 LEURICHRPT,Leucine-rich repeat signature

LSYIDLSQNNLSGS

HMMPfam: PF00560
IPR001611
261-279 LRR_1
Leucine-rich repeat

LSYIDLSQNNLSGSIPPFR

Gene3D: G3DSA:3.80.10.10
287-478 no description

VLKYLSLDKNMLSGEIPHSLGNLASLSSLLLSHNNLHGQIPESFSNLTSLQTLNLNYNNLSGTVPPALYNISSLIFLGLGANQLVGRLPADIGNTLTSITNLILEGNKFEGPLPSSLDNATNLQVLDLRSNTFAGVIPSLGSLSKLSYLDLGVNRLEAGDSTFLSSLKNSTQLLELWLDRNHLQGVISAYIT

HMMPfam: PF13855
288-346 LRR_8,Leucine rich repeat

LKYLSLDKNMLSGEIPHSLGNLASLSSLLLSHNNLHGQIPESFSNLTSLQTLNLNYNNL

Seg: seg
304-323 seg

HSLGNLASLSSLLLSHNNLH

HMMSmart: SM00369
IPR003591
309-332 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LASLSSLLLSHNNLHGQIPESFSN

Seg: seg
329-347 seg

SFSNLTSLQTLNLNYNNLS

HMMSmart: SM00369
IPR003591
333-357 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLQTLNLNYNNLSGTVPPALYNI

HMMPfam: PF12799
407-454 LRR_4,Leucine Rich repeats (2 copies)

TNLQVLDLRSNTFAGVIPSLGSLSKLSYLDLGVNRLEAGDSTFLSSLK

HMMSmart: SM00369
IPR003591
429-452 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSKLSYLDLGVNRLEAGDSTFLSS

Gene3D: G3DSA:3.80.10.10
482-737 no description

KSLKVLVLIENKLTGPIPSEIGNFMNLTVLQVDNNLLSGYIPDMLGNLRNLSILTLSCNKLSGEIPQSIGKLDQLTMLNFGGNDLTGLIPSSINGCKHLTTLNLSSNSLYGAIPEELFSISTLSEGLDLSYNQLTGDIPLEIGRLINLNLLNLSNNQLSGEIPTTLGQCLLLDSLHLEKNFLKGSIPNSFISLQGISEMDLSQNNLSGRIPEYFESFTLLRFLNLSFNDLEGAVPGGGVFANASDVFIQGNGKLCA

superfamily: SSF52058
482-744 L domain-like,LRR

KSLKVLVLIENKLTGPIPSEIGNFMNLTVLQVDNNLLSGYIPDMLGNLRNLSILTLSCNKLSGEIPQSIGKLDQLTMLNFGGNDLTGLIPSSINGCKHLTTLNLSSNSLYGAIPEELFSISTLSEGLDLSYNQLTGDIPLEIGRLINLNLLNLSNNQLSGEIPTTLGQCLLLDSLHLEKNFLKGSIPNSFISLQGISEMDLSQNNLSGRIPEYFESFTLLRFLNLSFNDLEGAVPGGGVFANASDVFIQGNGKLCATSPILHV

HMMPfam: PF13855
507-566 LRR_8,Leucine rich repeat

NLTVLQVDNNLLSGYIPDMLGNLRNLSILTLSCNKLSGEIPQSIGKLDQLTMLNFGGNDL

HMMSmart: SM00369
IPR003591
529-553 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLSILTLSCNKLSGEIPQSIGKL

HMMSmart: SM00369
IPR003591
577-601 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

CKHLTTLNLSSNSLYGAIPEELFSI

Seg: seg
580-590 seg

LTTLNLSSNSL

FPrintScan: PR00019
626-639 LEURICHRPT,Leucine-rich repeat signature

LINLNLLNLSNNQL

HMMSmart: SM00369
IPR003591
626-650 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LINLNLLNLSNNQLSGEIPTTLGQC

Seg: seg
628-640 seg

NLNLLNLSNNQLS

HMMPfam: PF00560
IPR001611
628-649 LRR_1
Leucine-rich repeat

NLNLLNLSNNQLSGEIPTTLGQ

HMMPfam: PF13855
653-711 LRR_8,Leucine rich repeat

LDSLHLEKNFLKGSIPNSFISLQGISEMDLSQNNLSGRIPEYFESFTLLRFLNLSFNDL

HMMSmart: SM00369
IPR003591
698-723 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FTLLRFLNLSFNDLEGAVPGGGVFAN

Seg: seg
771-782 seg

VAVIAACVAVII

Gene3D: G3DSA:3.30.200.20
774-893 no description

IAACVAVIILKKKRQAKTLTDQSLKQFKNFSYTDLFKATDGFSPNNLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALI

superfamily: SSF56112
IPR011009
801-1103 Protein kinase-like (PK-like)
Protein kinase-like domain

KNFSYTDLFKATDGFSPNNLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALILEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDVYA

HMMSmart: SM00219
IPR020635
815-1105 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSPNNLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALILEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDVYAEI

HMMSmart: SM00220
IPR002290
815-1113 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSPNNLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALILEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDVYAEILSIKEEFS

ProfileScan: PS50011
IPR000719
815-1113 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSPNNLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALILEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDVYAEILSIKEEFS

HMMPfam: PF00069
IPR000719
819-1101 Pkinase,Ser-thr
Protein kinase, catalytic domain

NLVGSGRFGMVYKGQLKFELCAVAIKVFRSDQLGAPSNFLSECEALRNTRHRNLLRVISVCSTFDPIGTEFKALILEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDV

PatternScan: PS00107
IPR017441
821-844 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGSGRFGMVYKGQLKFELCAVAIK

Gene3D: G3DSA:1.10.510.10
894-1103 no description

LEYMGHGNLEGWLHPEEYRKSTKGPLSLDSRIKIAVDVAAALDYLHNRCAPPLVHCDLKPSNVLLNDEMVACLGDFGLAKFLSSDSSTSSIAGPRGSVGYIAPEYGMGCKVSIEGDIYSYGIMLLEMITGKRPTDEMFKDGINLRGFVKSSLPLKINEILEPNLTRYLEGEDTDQVMGGIQKCALQLANLGLVCSEMSPKDRPTTEDVYA

PatternScan: PS00108
IPR008271
946-958 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

LVHCDLKPSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox