PRGDB00181465 (Si025938m)

From PRG Wiki
Jump to: navigation, search
Si025938m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit); disease resistance protein RPM1, putative (best rice hit)

DNA Sequence

ATGGCGGAGGCTGTTGTTGGAGTGCTACTCGGCAAGCTCAGTGTGGCCCTGATGAACGAGGCAGCAACCTATGCTTCATCCATCATTTGCAAGGAATCTTCTGAGCTCAAGGCTCTCTTTGGGGAGATCCGCAAAGCTGAGGGTGAGCTCGAGATCATGAAGGCATACCTGCATGACTCAGAGAAGCTCAAGGATACCAACGAGATTGCTGGCATCTTTGTCAATAAGATTCGAGATCTAGCTTTCCGGATTGAGGATGTGGTCGATGAGTTTGCATACAAGATTGAGGACAACAAGCAAGAAGGGTTTAGAGCCAAGATGAAAAAAATGCTTAAGAACGGCAAGACTTGGCGCCGTTTAGCTCTTGAGCTCCGCGATATCAATTGCAAGCTTGAAGATGCTGCAAAAAGGAAGGACCTTTATGCCATGCCAGGGATGGAAAGAGGTGCTAGAGACTGTGACCATCATGCTAGAACTACCAATCAAACTTCATGTTTTGCAAGGGACGAGGATCTTGTAGGTATTCAGGATAATGCAGAAAAGCTTAAGCGGTGGTTAGTAGGTGATTTTGAAGAAAGGTACAAAATCGCCACTGTTTGGGGGATGGGTGGCGTAGGTAAAACTAGTCTAGTTGATTATGTCTATAGGATTGTGAAAGTGGAGTTTGATGCTGCTGCATGGATAACAGTGTCAAAAAGTTACAAAGTTGAGGAGTTGCTGAGGAAGGTTGCTAGAGAGTTTGGCATTACAATTGACGTCAGCAACATGGAACTGAGAAGCCTAGTTGAGGTCATTCGTAGCCATCTTAAAGGTAAAAGGTATATTTTAGTTCTGGATGATATCTGGGAAAAAGATTTATGGATCAATAAAATCATGGATGTCTTTCCGACAAACTGGGTCAGCCGATTTGTTTTCACATCAAGAAAATACGAAGTTGCATCATTAGCAACCCGTAACTGTGCAGTTAAGCTAGATCCTATGGGAGAAAATCACTCTTGGAAGTTGTTTTGCAGGTTAGCTTTCCGGAATAATGATGAGAAAAGTTGCCCTACAGAGTTACATGATTTGGCCATGAAGTTCTTACGGAAGTGTGAAGGGTTGCCTATTGCTATTGCATGCATAGGTCGTTTATTGTCCTGCAAACCCTCGACCTTAACTGAATGGAACAATGTTTACGAGGAGTTAGAATTACAGTCGACTAATAATGTTATTCCTGGAGTTGATACTATTCTTAAAGTTAGCTTGGAGGACCTTCCATATGAATTGAAGAACTGCTTCTTGCATTGTGCAATATTTCCAGAGGATTGTTTATTGAAGAGAAAGCGGTTAATAAGGCATTGGATTACTGCTGGATTCATAAAGAAAAAGGAAAGTAAGACACTCGAAGAAGTGGCAGAGGGGTGCTTGAATGAGCTTGTAAACCGAAGTTTACTACAAGTCGTGAAGAAGAATGAGTTTGGACGAGTGAAATGTTGTCGAATGCATGATATCATCCACCATCTTGCCCTTGAAAAAGCAAAGGAAGAATGCTTTGGTAAAGTTTATGAGGGCCCGGAGACATTTTCAGTAGACAGCACACGACGATTATCTATACAGAGCACCAATATTGAACCTCTATGTCAATCTGGTGTAACACATCTCCGTGCAATTCATGCTTTCACAAGTGACGTCGATATTGATTTGCTGAGGCCTATCTTTATGTCTTCCCATTTGTTGTCAACATTAGATCTGCAAGGTACTAAAATCAAAATGTTGCCTAATGAGGTCTTCAACTTGTTCAATCTGCGATTTTTGGGTCTCAGATATACTGAAATTGAAATTCTACCAAAGGCATTAGGAAGACTTAAAAACTTAGAAGTACTGGATGCCTTGTTTACTCCTCTGCTCTCTTTACCAGAGGAAGTAGCGAAACTACAGAGGCTTTGGTTCCTCTACGCATGTACACTGCACAAGGAACGAACTCTTCAACGTTATGGTGGAATTAAAGTGCCTAGGACCATAAGGAACTTAACCGGACTGCATGCTATGGAAACTATTGAAGCAACATTAGAAACTCTATGCGATGTTGCATCTTTGACTGAATTAAGAGCATTTTCTGTTTGCGATGTGAAAAGTGAACACTCTTTAAACCTTTGCAGAGCTATAATGAACATGAGCCATCTGGTTCATCTGTCCATTGCAGCATTAGACGAAAATCAAGTATTACCTTTGGAAGCACTCTGTTTGCCCGGAACACTTTCTAAACTTGTATTGCAAGGGTGGCTGGAAAAGAAACGGATGCCTAGGATTCTCTCATCCTGGTTACACCTTAACAATCTCTCTAAACTGTCTCTTATATTCTCCAAACTTGATGAAGACTCATTTTCTAGTCTCAAGGTATTAGGTGGTTTATGCTACCTTGAACTGGTTAAGGCTTATGATGGGAAGAAATTGTTCTTTTCTGCATTGTCATTTCCTAGGCTCCGCCGACTAGCAATATGGAGTGCTCAGCAGCTGAACCGAGTTGAAATTGAAGAAGGCGCACTGGAATCCCTTGAAGAGCTAATGTTTACAGACTGCCCAGAATTGAATTGTCTCCCTTATGGCATTGAGTTCCTCAAAGACCTTGAAGAATTACGTTTGGAAGACACTGCAGAGGAGCTCATAGAGAAGCTTAGGCAGGAAAGTAGAGGACATCAAGACAATGAAGAACTTGTGAAGATTAGCCATGTTAGAAAGGTTGTTATTATATTATCAGAGAAAAACATACGGGAAAGAATTCGTTGA


Protein sequences

Name Description Sequence
Si025938m NB-ARC domain-containing disease resistance protein (best arabidopsis hit); disease resistance protein RPM1, putative (best rice hit)

MAEAVVGVLLGKLSVALMNEAATYASSIICKESSELKALFGEIRKAEGELEIMKAYLHDSEKLKDTNEIAGIFVNKIRDLAFRIEDVVDEFAYKIEDNKQEGFRAKMKKMLKNGKTWRRLALELRDINCKLEDAAKRKDLYAMPGMERGARDCDHHARTTNQTSCFARDEDLVGIQDNAEKLKRWLVGDFEERYKIATVWGMGGVGKTSLVDYVYRIVKVEFDAAAWITVSKSYKVEELLRKVAREFGITIDVSNMELRSLVEVIRSHLKGKRYILVLDDIWEKDLWINKIMDVFPTNWVSRFVFTSRKYEVASLATRNCAVKLDPMGENHSWKLFCRLAFRNNDEKSCPTELHDLAMKFLRKCEGLPIAIACIGRLLSCKPSTLTEWNNVYEELELQSTNNVIPGVDTILKVSLEDLPYELKNCFLHCAIFPEDCLLKRKRLIRHWITAGFIKKKESKTLEEVAEGCLNELVNRSLLQVVKKNEFGRVKCCRMHDIIHHLALEKAKEECFGKVYEGPETFSVDSTRRLSIQSTNIEPLCQSGVTHLRAIHAFTSDVDIDLLRPIFMSSHLLSTLDLQGTKIKMLPNEVFNLFNLRFLGLRYTEIEILPKALGRLKNLEVLDALFTPLLSLPEEVAKLQRLWFLYACTLHKERTLQRYGGIKVPRTIRNLTGLHAMETIEATLETLCDVASLTELRAFSVCDVKSEHSLNLCRAIMNMSHLVHLSIAALDENQVLPLEALCLPGTLSKLVLQGWLEKKRMPRILSSWLHLNNLSKLSLIFSKLDEDSFSSLKVLGGLCYLELVKAYDGKKLFFSALSFPRLRRLAIWSAQQLNRVEIEEGALESLEELMFTDCPELNCLPYGIEFLKDLEELRLEDTAEELIEKLRQESRGHQDNEELVKISHVRKVVIILSEKNIRERIR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
14-921 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SVALMNEAATYASSIICKESSELKALFGEIRKAEGELEIMKAYLHDSEKLKDTNEIAGIFVNKIRDLAFRIEDVVDEFAYKIEDNKQEGFRAKMKKMLKNGKTWRRLALELRDINCKLEDAAKRKDLYAMPGMERGARDCDHHARTTNQTSCFARDEDLVGIQDNAEKLKRWLVGDFEERYKIATVWGMGGVGKTSLVDYVYRIVKVEFDAAAWITVSKSYKVEELLRKVAREFGITIDVSNMELRSLVEVIRSHLKGKRYILVLDDIWEKDLWINKIMDVFPTNWVSRFVFTSRKYEVASLATRNCAVKLDPMGENHSWKLFCRLAFRNNDEKSCPTELHDLAMKFLRKCEGLPIAIACIGRLLSCKPSTLTEWNNVYEELELQSTNNVIPGVDTILKVSLEDLPYELKNCFLHCAIFPEDCLLKRKRLIRHWITAGFIKKKESKTLEEVAEGCLNELVNRSLLQVVKKNEFGRVKCCRMHDIIHHLALEKAKEECFGKVYEGPETFSVDSTRRLSIQSTNIEPLCQSGVTHLRAIHAFTSDVDIDLLRPIFMSSHLLSTLDLQGTKIKMLPNEVFNLFNLRFLGLRYTEIEILPKALGRLKNLEVLDALFTPLLSLPEEVAKLQRLWFLYACTLHKERTLQRYGGIKVPRTIRNLTGLHAMETIEATLETLCDVASLTELRAFSVCDVKSEHSLNLCRAIMNMSHLVHLSIAALDENQVLPLEALCLPGTLSKLVLQGWLEKKRMPRILSSWLHLNNLSKLSLIFSKLDEDSFSSLKVLGGLCYLELVKAYDGKKLFFSALSFPRLRRLAIWSAQQLNRVEIEEGALESLEELMFTDCPELNCLPYGIEFLKDLEELRLEDTAEELIEKLRQESRGHQDNEELVKISHVRKVVIILSEKNIRERIR

HMMPanther: PTHR23155:SF125
14-921 PUTATIVE RPR1 (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01G0547000 PROTEIN),PUTATIVE RPR1 (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01G0547000 PROTEIN)

SVALMNEAATYASSIICKESSELKALFGEIRKAEGELEIMKAYLHDSEKLKDTNEIAGIFVNKIRDLAFRIEDVVDEFAYKIEDNKQEGFRAKMKKMLKNGKTWRRLALELRDINCKLEDAAKRKDLYAMPGMERGARDCDHHARTTNQTSCFARDEDLVGIQDNAEKLKRWLVGDFEERYKIATVWGMGGVGKTSLVDYVYRIVKVEFDAAAWITVSKSYKVEELLRKVAREFGITIDVSNMELRSLVEVIRSHLKGKRYILVLDDIWEKDLWINKIMDVFPTNWVSRFVFTSRKYEVASLATRNCAVKLDPMGENHSWKLFCRLAFRNNDEKSCPTELHDLAMKFLRKCEGLPIAIACIGRLLSCKPSTLTEWNNVYEELELQSTNNVIPGVDTILKVSLEDLPYELKNCFLHCAIFPEDCLLKRKRLIRHWITAGFIKKKESKTLEEVAEGCLNELVNRSLLQVVKKNEFGRVKCCRMHDIIHHLALEKAKEECFGKVYEGPETFSVDSTRRLSIQSTNIEPLCQSGVTHLRAIHAFTSDVDIDLLRPIFMSSHLLSTLDLQGTKIKMLPNEVFNLFNLRFLGLRYTEIEILPKALGRLKNLEVLDALFTPLLSLPEEVAKLQRLWFLYACTLHKERTLQRYGGIKVPRTIRNLTGLHAMETIEATLETLCDVASLTELRAFSVCDVKSEHSLNLCRAIMNMSHLVHLSIAALDENQVLPLEALCLPGTLSKLVLQGWLEKKRMPRILSSWLHLNNLSKLSLIFSKLDEDSFSSLKVLGGLCYLELVKAYDGKKLFFSALSFPRLRRLAIWSAQQLNRVEIEEGALESLEELMFTDCPELNCLPYGIEFLKDLEELRLEDTAEELIEKLRQESRGHQDNEELVKISHVRKVVIILSEKNIRERIR

superfamily: SSF52540
155-403 P-loop containing nucleoside triphosphate hydrolases

HHARTTNQTSCFARDEDLVGIQDNAEKLKRWLVGDFEERYKIATVWGMGGVGKTSLVDYVYRIVKVEFDAAAWITVSKSYKVEELLRKVAREFGITIDVSNMELRSLVEVIRSHLKGKRYILVLDDIWEKDLWINKIMDVFPTNWVSRFVFTSRKYEVASLATRNCAVKLDPMGENHSWKLFCRLAFRNNDEKSCPTELHDLAMKFLRKCEGLPIAIACIGRLLSCKPSTLTEWNNVYEELELQSTNNV

Gene3D: G3DSA:3.40.50.300
169-283 no description

DEDLVGIQDNAEKLKRWLVGDFEERYKIATVWGMGGVGKTSLVDYVYRIVKVEFDAAAWITVSKSYKVEELLRKVAREFGITIDVSNMELRSLVEVIRSHLKGKRYILVLDDIWE

HMMPfam: PF00931
IPR002182
176-456 NB-ARC,NBS
NB-ARC

QDNAEKLKRWLVGDFEERYKIATVWGMGGVGKTSLVDYVYRIVKVEFDAAAWITVSKSYKVEELLRKVAREFGITIDVSNMELRSLVEVIRSHLKGKRYILVLDDIWEKDLWINKIMDVFPTNWVSRFVFTSRKYEVASLATRNCAVKLDPMGENHSWKLFCRLAFRNNDEKSCPTELHDLAMKFLRKCEGLPIAIACIGRLLSCKPSTLTEWNNVYEELELQSTNNVIPGVDTILKVSLEDLPYELKNCFLHCAIFPEDCLLKRKRLIRHWITAGFIKKK

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

IATVWGMGGVGKTSLV

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

HLKGKRYILVLDDIW

FPrintScan: PR00364
IPR000767
364-378 DISEASERSIST
Disease resistance protein

CEGLPIAIACIGRLL

superfamily: SSF52058
493-876 L domain-like,LRR

RMHDIIHHLALEKAKEECFGKVYEGPETFSVDSTRRLSIQSTNIEPLCQSGVTHLRAIHAFTSDVDIDLLRPIFMSSHLLSTLDLQGTKIKMLPNEVFNLFNLRFLGLRYTEIEILPKALGRLKNLEVLDALFTPLLSLPEEVAKLQRLWFLYACTLHKERTLQRYGGIKVPRTIRNLTGLHAMETIEATLETLCDVASLTELRAFSVCDVKSEHSLNLCRAIMNMSHLVHLSIAALDENQVLPLEALCLPGTLSKLVLQGWLEKKRMPRILSSWLHLNNLSKLSLIFSKLDEDSFSSLKVLGGLCYLELVKAYDGKKLFFSALSFPRLRRLAIWSAQQLNRVEIEEGALESLEELMFTDCPELNCLPYGIEFLKDLEELRLED

Seg: seg
590-601 seg

FNLFNLRFLGLR

Gene3D: G3DSA:3.80.10.10
705-876 no description

SEHSLNLCRAIMNMSHLVHLSIAALDENQVLPLEALCLPGTLSKLVLQGWLEKKRMPRILSSWLHLNNLSKLSLIFSKLDEDSFSSLKVLGGLCYLELVKAYDGKKLFFSALSFPRLRRLAIWSAQQLNRVEIEEGALESLEELMFTDCPELNCLPYGIEFLKDLEELRLED

Seg: seg
836-848 seg

EIEEGALESLEEL

FPrintScan: PR00364
IPR000767
840-856 DISEASERSIST
Disease resistance protein

GALESLEELMFTDCPEL

Coil: coil
875-896 coiled-coil

EDTAEELIEKLRQESRGHQDNE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox