PRGDB00181466 (Si026243m)

From PRG Wiki
Jump to: navigation, search
Si026243m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Setaria italica

Comment?

protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (best arabidopsis hit); cysteine-rich receptor-like protein kinase 12 precursor, putative (best rice hit)

DNA Sequence

ATGGACAGATGCATTGAAATAGCACAAATTTGTGTTCACCATGACCCAAGTAAAAGACCTACTGCGTGTGACATAATCGTTATGCTTAACCGGACAGAAGCCATGACTCAAAAGGTTCCTTCGTTTTTTAATAGGCTAAGAACTGATCCACCGTTTTCATTACGGCAGATGGTGCAAAGATTCAAGAAAACGTTCTCACAAACTCTTTGCGAGCATTGCAGAATGGTCGACATATCTGATGATCTTAATATACTGGAGCGTATACTTGAGGGAAGCCAGAAGCCGAGTAAGATATCATATCCACTTCTGCAGTTCATCACCAGAAATTTCTCTGATGAACGAAAAATTGGTCACAATGAACTTGGAGATTTTTTCAAGGGAATCCTGCGGATCGTTGCTGTGACAAGGCTTTCTAGGAGCCTCAGTATTAGCGATAAGATCTTTCATCAGGAGGTTAAACTCATGACGATGGCTCAGCATGGAAATATAATACGGTTGCTAGGCAACTGTTCGTATGCAGAAGAAAATGTAGGACAAGATGGAGAAATTACCATCGATGAGAGGGAAAGATTGCTCTGTTTTGAGTATTTAAGCAAAGGAAGCCTTAAGAAGCATCTTTCTGATGAATTAAGGGGACTTCAGTGGCATACACGATATCAGATAATCAGGGGAATCTGTGAGGGTTTACGTTATCTTCACAAGGAAAGGGCAATTGTTCACATGTATCTCAGGCCCGCATGTATAATACTGGATGATTTTATGGTTCCAAAGATCACAGAGTTTGGTATATCAGAACTTGTAATGACAAGCACTAACCATCATCAACAGCGAGAATATTTGGCTCCGGAGAGCATATCGAACGGCAGTGTGTCATTTAAAGCGGACATTTATAGTTTGGGTATCATAATCAGAGAGTTGGTGACCGGAAGTAAGGAGACACCCTGTCTTATTAAAGTACTCCGGAGATGGAAACACAGGTGGGGCAAATCAGGTCCATTGTGGTGCCTACAAATAAAGAAATGCCTGGAATTGGCGCAAAGTTGCATGCAAAAAGACCCAAACAAAAGACCTCCTATATCCCACATAGTCGGTGAACTCAACGAATTGGATACTAACGCCAATGTTTCTACACTTGATCAGATAAATTCTTGCTTGGAGGACATGCTTGAGATTGAGCCACTTGAGCTTCATTTCCGGTTTGAGCATAATAAGGCGATAACACGCTCGGTTGAGCTGATCAATGATACAGACGATGCCTTCGCCTTCAGAATCACAGCCTCGAGCTCACTCCCGTACTACACAAAGCCAAGCAAAAGTATCGTTGGACCGCGATCCAGGTGCAGTGTCACCGTAGCATTGGAAGCACTTGAGATGGCACCGGAGCAATGCAAGTATGGTGCATCACGGTTCTATGTGCAGAGCACCAGAGTGGTTGAGAGTCTTACAGCTGAGGATATAACTGAAGACATGTTCGACGAAGAGACTGATGGTAAAGTGGTCGATAAGGTGGATTTGATTGTTTTCCTTGAGTGA


Protein sequences

Name Description Sequence
Si026243m protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (best arabidopsis hit); cysteine-rich receptor-like protein kinase 12 precursor, putative (best rice hit)

MDRCIEIAQICVHHDPSKRPTACDIIVMLNRTEAMTQKVPSFFNRLRTDPPFSLRQMVQRFKKTFSQTLCEHCRMVDISDDLNILERILEGSQKPSKISYPLLQFITRNFSDERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQHGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVGELNELDTNANVSTLDQINSCLEDMLEIEPLELHFRFEHNKAITRSVELINDTDDAFAFRITASSSLPYYTKPSKSIVGPRSRCSVTVALEALEMAPEQCKYGASRFYVQSTRVVESLTAEDITEDMFDEETDGKVVDKVDLIVFLE*

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-49 Protein kinase-like (PK-like)
Protein kinase-like domain

DRCIEIAQICVHHDPSKRPTACDIIVMLNRTEAMTQKVPSFFNRLRTD

superfamily: SSF56112
IPR011009
82-389 Protein kinase-like (PK-like)
Protein kinase-like domain

LNILERILEGSQKPSKISYPLLQFITRNFSDERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQHGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVGELNELDTNANVSTLDQINSCLEDML

Gene3D: G3DSA:3.30.200.20
95-159 no description

PSKISYPLLQFITRNFSDERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQ

HMMPanther: PTHR24420:SF748
103-431 OS11G0226100 PROTEIN

LQFITRNFSDERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQHGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVGELNELDTNANVSTLDQINSCLEDMLEIEPLELHFRFEHNKAITRSVELINDTDDAFAFRITASSSLP

HMMPanther: PTHR24420
103-431 FAMILY NOT NAMED,FAMILY NOT NAMED

LQFITRNFSDERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQHGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVGELNELDTNANVSTLDQINSCLEDMLEIEPLELHFRFEHNKAITRSVELINDTDDAFAFRITASSSLP

HMMSmart: SM00219
IPR020635
110-366 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQHGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVGEL

HMMSmart: SM00220
IPR002290
110-364 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQHGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVG

ProfileScan: PS50011
IPR000719
110-369 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQHGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVGELNEL

HMMPfam: PF07714
IPR001245
113-366 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

ERKIGHNELGDFFKGILRIVAVTRLSRSLSISDKIFHQEVKLMTMAQHGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVGEL

Gene3D: G3DSA:1.10.510.10
160-366 no description

HGNIIRLLGNCSYAEENVGQDGEITIDERERLLCFEYLSKGSLKKHLSDELRGLQWHTRYQIIRGICEGLRYLHKERAIVHMYLRPACIILDDFMVPKITEFGISELVMTSTNHHQQREYLAPESISNGSVSFKADIYSLGIIIRELVTGSKETPCLIKVLRRWKHRWGKSGPLWCLQIKKCLELAQSCMQKDPNKRPPISHIVGEL

superfamily: SSF49354
IPR008962
383-510 PapD-like
PapD-like

SCLEDMLEIEPLELHFRFEHNKAITRSVELINDTDDAFAFRITASSSLPYYTKPSKSIVGPRSRCSVTVALEALEMAPEQCKYGASRFYVQSTRVVESLTAEDITEDMFDEETDGKVVDKVDLIVFLE

Gene3D: G3DSA:2.60.40.360
IPR008962
386-501 no description
PapD-like

EDMLEIEPLELHFRFEHNKAITRSVELINDTDDAFAFRITASSSLPYYTKPSKSIVGPRSRCSVTVALEALEMAPEQCKYGASRFYVQSTRVVESLTAEDITEDMFDEETDGKVVD

ProfileScan: PS50202
IPR000535
388-509 MSP
Major sperm protein

MLEIEPLELHFRFEHNKAITRSVELINDTDDAFAFRITASSSLPYYTKPSKSIVGPRSRCSVTVALEALEMAPEQCKYGASRFYVQSTRVVESLTAEDITEDMFDEETDGKVVDKVDLIVFL

HMMPfam: PF00635
IPR000535
389-492 Motile_Sperm
Major sperm protein

LEIEPLELHFRFEHNKAITRSVELINDTDDAFAFRITASSSLPYYTKPSKSIVGPRSRCSVTVALEALEMAPEQCKYGASRFYVQSTRVVESLTAEDITEDMFD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox