PRGDB00181467 (Si026021m)

From PRG Wiki
Jump to: navigation, search
Si026021m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Setaria italica

Comment?

wall associated kinase 4 (best arabidopsis hit); wall-associated receptor kinase 3 precursor, putative (best rice hit)

DNA Sequence

ATGGTGCTCTGGTTTCTCCTTATTCCTACCTTAGCATTTTCCTATCTAATAATTCCACTGCCGCCATTGGTGGCAGGAGCCTCCGGTTCCAACATAGCGCCACCACCACCGGCATTGCCAGCAGCTCCAAGGCCGGGCTGCCCTAGCATGTGCGGCAATGTAAACATTCCCTACCCATTCGGCATCGGGGTCGAATGTGCCTGGCGGCCGGGCATGGGCTTCTCCATCACTTGCGACCATAGCTATAACCCTCCAAGACCATACACAGGCGACTTCGAGGTCATCAGCATCTCGTTGGAGGCCGGCGAGATGCATGTCTTCTCCGACGTGGCCTACATCTGCTACAACTCATCCACCACCACTGCATCCAACGGAGTCAGCGCCTGGACACTCAGCTTCAACCCCGCATTTCTCATCTCCCCAACTCGCAACATCTTTACAGGCATCGGCTGCGACGCGATTGCATTTCTAAACGGCAGAGAGGATTTCAGCTTCTTCACTGGCTGCATCACCTCATGCAACAGCTTGCATGCAGCGGCTGAAGACGGCGAGGAGTGCACGGGGCTTGGCTGCTGCCAGAGTTCCATCCCAACCAACCTCTCCACGATAAAGATCTACTGGGGGAACAACGAGAGCTATACGCCTACAAATCTAGCGTGGGAATACAGCCCCTGCAACTACGCTTTTATCGGGGAGAACGACTGGTACCACTTCAATCAGAGTGATCTCAAACGTGATGCCAATAACAAGACCTTTATTGACCGTGTTGGAAACAGAACCATCCCCATGGTGCTTGATTGGTCCATCAGGGATGGCATGTCTTGCCAGGCACCAACAAAGGATTATGCTGGGGCACCGACAGCTCCTGCTTGCATCAGTAGAAATAGCTTCTGTGTTAACGCCGCACACGGACCTGGGTACCTCTGCAATTGTTCCAAGGGCTACACGGGCAACCCCTACGTCACCGATGGCTGCACAAACATTAACGAGTGCAAACTTCGAAAATCAAATCCTGCGATTTATGAAAAACTTTGTGGCAGTAATAGCAAATGCCATGACACACAGGGCGATTACGAGTGCAAATGCAAATTTGGACACAAAGGAGATGGTAAAAGTGAGAAAGGATGCCAGCCCATAATTGAAGGATATGCAATCGCTATAGTAGTTACATTGGTCTCCCTCACTATTCTGGTGATCCTACTATGTCTTCTGTACATGGAGTACAGACGACGTATTCGGAGAGGGCACTTTGACAAAAATGGTGGTAAAATCCTAGAGGGCGCTGCGAACATCGTCACCTTCTCGGAAGATGAGTTGAGGAAGATCACAAACAACTTCTCGAAAGATCGTCAAATTGGAAGAGGTGCCTTTGGCATGGTCTACAAAGGCACCACCGATGACAACAAGCGAGTCGCGGTTAAACGACCCATAGTAGAAGGAGAGAAATCCCGGCAAGGGGGTGAATTCGTCGACGAGATCATCTTCCAATTCGCCATCAGCCACACCAACATTGTGCGCCTCGTTGGGTGCTGCCTGGAGACGAGCATCCCCATGCTGGTATTTGAGTTCATCCCCAACGGAAGCCTCTCCGACATGCTCCACGGTGCCGGCAAGCAAGGCTCTCTTTCTTTGCAGATGCGACTTGACATTGCCATTGGCTCTGCAGAAGCTCTCACCTACATGCACTCACATGATGCCGGACACAACAACCGCATCCACGGGGACGTGAAGTCTGGAAACATCCTGCTCGACGACGACCTCAACCCCAAGGTCTCGGACTTTGGGTCGTCCAAGCTCGTGTCCATTGCTAGCAGGTATGCCAAATGGGCGGTGTCAGGGGACATGAGCTACATTGACCCGGTGTACATCAACACTGGTTCTTTCACGGAGAAGAGCGACGTGTACAGCTTCGGCGTGGTACTCCTGGAGCTCATCACCAGAAAGAAGGCCAGGTATGACGGGTGCAACAGCCTCCCCATGAACTTTGTAAAGACTTGCAAGAAGGAGGGCAACGGATGGAAGATGTATGACAGAGACATCTTCTCTGGTGAGGATGCTCAGACGTCTCAACGTTACATTGAGTGCCTCGACAGGATAGGCGCGTTGGCTGTCCGATGTCTCAAGGAAGATGTGGAGGAGAGACCAACCATGGCAGAGGTGGTGGAAAAGCTTAAGCAAGTGAAGTTAATAGCCTTCGGAAACTCAGGCTCAGAGGCGAGATGA


Protein sequences

Name Description Sequence
Si026021m wall associated kinase 4 (best arabidopsis hit); wall-associated receptor kinase 3 precursor, putative (best rice hit)

MVLWFLLIPTLAFSYLIIPLPPLVAGASGSNIAPPPPALPAAPRPGCPSMCGNVNIPYPFGIGVECAWRPGMGFSITCDHSYNPPRPYTGDFEVISISLEAGEMHVFSDVAYICYNSSTTTASNGVSAWTLSFNPAFLISPTRNIFTGIGCDAIAFLNGREDFSFFTGCITSCNSLHAAAEDGEECTGLGCCQSSIPTNLSTIKIYWGNNESYTPTNLAWEYSPCNYAFIGENDWYHFNQSDLKRDANNKTFIDRVGNRTIPMVLDWSIRDGMSCQAPTKDYAGAPTAPACISRNSFCVNAAHGPGYLCNCSKGYTGNPYVTDGCTNINECKLRKSNPAIYEKLCGSNSKCHDTQGDYECKCKFGHKGDGKSEKGCQPIIEGYAIAIVVTLVSLTILVILLCLLYMEYRRRIRRGHFDKNGGKILEGAANIVTFSEDELRKITNNFSKDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCCLETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEKLKQVKLIAFGNSGSEAR*

Domains

Domain Start-End Description Sequence

Seg: seg
33-45 seg

APPPPALPAAPRP

HMMPfam: PF13947
IPR025287
45-152 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

PGCPSMCGNVNIPYPFGIGVECAWRPGMGFSITCDHSYNPPRPYTGDFEVISISLEAGEMHVFSDVAYICYNSSTTTASNGVSAWTLSFNPAFLISPTRNIFTGIGCD

HMMSmart: SM00181
IPR006210
274-326 Epidermal growth factor-like domain.
Epidermal growth factor-like

SCQAPTKDYAGAPTAPACISRNSFCVNAAHGPGYLCNCSKGYTGNPYVTDGCT

HMMPanther: PTHR24420
290-727 FAMILY NOT NAMED,FAMILY NOT NAMED

ACISRNSFCVNAAHGPGYLCNCSKGYTGNPYVTDGCTNINECKLRKSNPAIYEKLCGSNSKCHDTQGDYECKCKFGHKGDGKSEKGCQPIIEGYAIAIVVTLVSLTILVILLCLLYMEYRRRIRRGHFDKNGGKILEGAANIVTFSEDELRKITNNFSKDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCCLETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEKLKQV

HMMPanther: PTHR24420:SF444
290-727 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ACISRNSFCVNAAHGPGYLCNCSKGYTGNPYVTDGCTNINECKLRKSNPAIYEKLCGSNSKCHDTQGDYECKCKFGHKGDGKSEKGCQPIIEGYAIAIVVTLVSLTILVILLCLLYMEYRRRIRRGHFDKNGGKILEGAANIVTFSEDELRKITNNFSKDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCCLETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEKLKQV

Gene3D: G3DSA:2.10.25.10
294-371 no description

RNSFCVNAAHGPGYLCNCSKGYTGNPYVTDGCTNINECKLRKSNPAIYEKLCGSNSKCHDTQGDYECKCKFGHKGDGK

PatternScan: PS01187
IPR018097
327-360 EGF_CA
EGF-like calcium-binding, conserved site

NINECKLRKSNPAIYEKLCGSNSKCHDTQGDYEC

ProfileScan: PS50026
IPR000742
327-377 EGF_3
Epidermal growth factor-like domain

NINECKLRKSNPAIYEKLCGSNSKCHDTQGDYECKCKFGHKGDGKSEKGCQ

HMMSmart: SM00179
IPR001881
327-377 Calcium-binding EGF-like domain
EGF-like calcium-binding

NINECKLRKSNPAIYEKLCGSNSKCHDTQGDYECKCKFGHKGDGKSEKGCQ

HMMSmart: SM00181
IPR006210
330-377 Epidermal growth factor-like domain.
Epidermal growth factor-like

ECKLRKSNPAIYEKLCGSNSKCHDTQGDYECKCKFGHKGDGKSEKGCQ

superfamily: SSF57196
337-376 EGF/Laminin

NPAIYEKLCGSNSKCHDTQGDYECKCKFGHKGDGKSEKGC

PatternScan: PS00010
IPR000152
351-362 ASX_HYDROXYL
EGF-type aspartate/asparagine hydroxylation site

CHDTQGDYECKC

Seg: seg
385-404 seg

IAIVVTLVSLTILVILLCLL

superfamily: SSF56112
IPR011009
418-724 Protein kinase-like (PK-like)
Protein kinase-like domain

DKNGGKILEGAANIVTFSEDELRKITNNFSKDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCCLETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEKL

Gene3D: G3DSA:3.30.200.20
431-511 no description

IVTFSEDELRKITNNFSKDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCC

HMMSmart: SM00220
IPR002290
446-730 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSKDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCCLETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEKLKQVKLI

ProfileScan: PS50011
IPR000719
446-729 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCCLETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEKLKQVKL

HMMSmart: SM00219
IPR020635
446-724 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSKDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCCLETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEKL

HMMPfam: PF07714
IPR001245
448-724 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

KDRQIGRGAFGMVYKGTTDDNKRVAVKRPIVEGEKSRQGGEFVDEIIFQFAISHTNIVRLVGCCLETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEKL

PatternScan: PS00107
IPR017441
452-474 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGAFGMVYKGTTDDNKRVAVK

Gene3D: G3DSA:1.10.510.10
512-723 no description

LETSIPMLVFEFIPNGSLSDMLHGAGKQGSLSLQMRLDIAIGSAEALTYMHSHDAGHNNRIHGDVKSGNILLDDDLNPKVSDFGSSKLVSIASRYAKWAVSGDMSYIDPVYINTGSFTEKSDVYSFGVVLLELITRKKARYDGCNSLPMNFVKTCKKEGNGWKMYDRDIFSGEDAQTSQRYIECLDRIGALAVRCLKEDVEERPTMAEVVEK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox