PRGDB00181468 (108463)

From PRG Wiki
Jump to: navigation, search
108463
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Selaginella moellendorffii

Comment?

disease resistance protein (TIR-NBS-LRR class) (best arabidopsis hit)

DNA Sequence

ATGGCGATTTACATATTGGAAAACCAGAAGAAGGCCACTGAGTATGCGTGCCTGTTTCTGTCTGGAAGGGAGTTTCCTGCAGGACTATGCAAAGGTACTGGCCAAGAGAAGTTCAACGCTAAGAAGCTTTCTTTGATAGGAAATCAGGTGGAGAACGTCGATAAGCTTGGAACTCGGGCTCCGGATGTGGAAGTGCTACTCCTTAGCAACAACATTCAGCTGAAACATCTTACCGGACGGTTTCTGTGGAGCTTTAAAAAGCTCCGTGTACTGGACCTGAGCAGGACGGGCTTAATATCTCTTCCCATGGAGATTGGGAAGCTCAAAGAGTTGGTCGTCCTCGACATTAGTTATAGCAGCATCCGATCTGTGCCGGACTCTTTGGGCAGGCTGGTGAAGTTGGAACATCTGAACATGCAAAACTGTCCATTGAAGAGCTTTCCAGTGCACAAAGTATCGAATCTCGTCAACTTGCGTTATCTCAACACAAGAGGCCTTTACTTCGAACAACTTTCAGTCATTCCAGACGAGCTCCAGTCTCTGGCCGCTCTAGAGGTTCTCGATGTCAACACTTGCAGATTACTCCAGAAGCTACCGGACTATCTCGCCAAGTCCTTCTTGGGACTGCTTGCTCTCGACCTTCGTGGCTGCACGTCGTTGTCGCAACTTCCTTCAGATCTGCAGGAACTACAATGGCTTCAAAAGCTGGATCTTGAAGGCTGCTTGTCCTTGCAATCTCTACCAGAGGCTTTCGGAAGTTCAGGTGCATTTCCTTCGTTACAAGAGCTTTTCATGACGGGATGCAGAAGACTAGAAGCATTTCCAGAATTGCAACCAGGGGCGCTTCCTCGTCTTCGTATGCTCAAACTGCCGTTTTGTGCGCGCCTGCAACACTTGGATATACATCCCAAGGCGCTGCCCAACCTTGTCCACTTGAACCTGGGTGGCTGTGCCGGATTGAAAGAGCTCCCTGACGAGGAAGCGTTGAGATATTTTTCATACTTGGAGGAGCTGGTTTTGAACAACACGCAAATATCTAGCTTACCTGCGAGTATAGGACTGCTTCCAAGGCTGAAGAAGCTG


Protein sequences

Name Description Sequence
108463 disease resistance protein (TIR-NBS-LRR class) (best arabidopsis hit)

MAIYILENQKKATEYACLFLSGREFPAGLCKGTGQEKFNAKKLSLIGNQVENVDKLGTRAPDVEVLLLSNNIQLKHLTGRFLWSFKKLRVLDLSRTGLISLPMEIGKLKELVVLDISYSSIRSVPDSLGRLVKLEHLNMQNCPLKSFPVHKVSNLVNLRYLNTRGLYFEQLSVIPDELQSLAALEVLDVNTCRLLQKLPDYLAKSFLGLLALDLRGCTSLSQLPSDLQELQWLQKLDLEGCLSLQSLPEAFGSSGAFPSLQELFMTGCRRLEAFPELQPGALPRLRMLKLPFCARLQHLDIHPKALPNLVHLNLGGCAGLKELPDEEALRYFSYLEELVLNNTQISSLPASIGLLPRLKKL


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-361 SSF52058,LRR

MAIYILENQKKATEYACLFLSGREFPAGLCKGTGQEKFNAKKLSLIGNQVENVDKLGTRAPDVEVLLLSNNIQLKHLTGRFLWSFKKLRVLDLSRTGLISLPMEIGKLKELVVLDISYSSIRSVPDSLGRLVKLEHLNMQNCPLKSFPVHKVSNLVNLRYLNTRGLYFEQLSVIPDELQSLAALEVLDVNTCRLLQKLPDYLAKSFLGLLALDLRGCTSLSQLPSDLQELQWLQKLDLEGCLSLQSLPEAFGSSGAFPSLQELFMTGCRRLEAFPELQPGALPRLRMLKLPFCARLQHLDIHPKALPNLVHLNLGGCAGLKELPDEEALRYFSYLEELVLNNTQISSLPASIGLLPRLKKL

Gene3D: G3DSA:3.80.10.10
39-253 G3DSA:3.80.10.10

NAKKLSLIGNQVENVDKLGTRAPDVEVLLLSNNIQLKHLTGRFLWSFKKLRVLDLSRTGLISLPMEIGKLKELVVLDISYSSIRSVPDSLGRLVKLEHLNMQNCPLKSFPVHKVSNLVNLRYLNTRGLYFEQLSVIPDELQSLAALEVLDVNTCRLLQKLPDYLAKSFLGLLALDLRGCTSLSQLPSDLQELQWLQKLDLEGCLSLQSLPEAFGS

HMMPanther: PTHR23155
62-361 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVEVLLLSNNIQLKHLTGRFLWSFKKLRVLDLSRTGLISLPMEIGKLKELVVLDISYSSIRSVPDSLGRLVKLEHLNMQNCPLKSFPVHKVSNLVNLRYLNTRGLYFEQLSVIPDELQSLAALEVLDVNTCRLLQKLPDYLAKSFLGLLALDLRGCTSLSQLPSDLQELQWLQKLDLEGCLSLQSLPEAFGSSGAFPSLQELFMTGCRRLEAFPELQPGALPRLRMLKLPFCARLQHLDIHPKALPNLVHLNLGGCAGLKELPDEEALRYFSYLEELVLNNTQISSLPASIGLLPRLKKL

HMMPfam: PF13504
87-102 LRR_7,Leucine rich repeat

KLRVLDLSRTGLISLP

HMMPfam: PF12799
110-148 LRR_4,Leucine Rich repeats (2 copies)

ELVVLDISYSSIRSVPDSLGRLVKLEHLNMQNCPLKSFP

HMMPfam: PF00560
IPR001611
211-230 LRR_1
Leucine-rich repeat

ALDLRGCTSLSQLPSDLQEL

HMMPfam: PF00560
IPR001611
233-252 LRR_1
Leucine-rich repeat

LQKLDLEGCLSLQSLPEAFG

Gene3D: G3DSA:3.80.10.10
254-361 G3DSA:3.80.10.10

SGAFPSLQELFMTGCRRLEAFPELQPGALPRLRMLKLPFCARLQHLDIHPKALPNLVHLNLGGCAGLKELPDEEALRYFSYLEELVLNNTQISSLPASIGLLPRLKKL

HMMPfam: PF00560
IPR001611
308-325 LRR_1
Leucine-rich repeat

NLVHLNLGGCAGLKELPD

HMMPfam: PF13504
334-349 LRR_7,Leucine rich repeat

YLEELVLNNTQISSLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox