PRGDB00181469 (Si025889m)

From PRG Wiki
Jump to: navigation, search
Si025889m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Setaria italica

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit); receptor-like protein kinase 2 precursor, putative, expressed (best rice hit)

DNA Sequence

ATGACATTGTTCTTCTTCTCTTTGTTCTTCTTCTGTTCCCATGCTCTGGTGTCTCTAGGGAGCAGCAATGCCACCGGTGATGAGCTCGCGCTACTCTCATTTAAGTCCATGCTGTCGACCCCGTCCAAGGTCTCGCTGGCATCATGGAACATGTCCAGTCACTTCTGCAGCTGGCAAGGAGTCGTTTGCGGTCGTCGGCATCCTGATAGGGTTGTCTCGCTGCACTTGAGCTCCTTCGACCTCTCGGGGCGCATCTCACCGTTCTTGGGAAACCTGTCATTTCTCCAGAAGGTTGAACTTGGCAACAACCAGCTTGTTGGGCATATACCGCCTGAGCTCGGTCGTCTCAGCAAGCTTCAGGAGCTGAATTTGAGCACAAATTTTCTCCAAGGAAGCATTCCTGTAGCCATGGGAGGTTGCACCAACCTCATGGTGCTTGATCTGAGCAACAACCAACTGCAAGGTGAGATCCCATCCGTGATAGGTGCCAGCATGAAAAATCTTGTCCAGCTTTACCTTCGAAAGAATCTTTTGACGGGAGTGATTCCCCAATCTCTTGCTGAGTTGTCATCGATTGAATTATTGTTTTTATCCCACAACAATTTAGATGGTGAGATACCATCTGCTTTGGGCAACCTCACAAACCTCTTGTCTATTGGTTTTTCTAACAACATGCTTTCAGGAGCTATCCCTTCATCTTTGGGTATGCTGCCAAATTTATCTATGCTCAGCGTAGGCTTTAACAATTTAACTGGACCAATACCCACTTCTATTTGGAACATTTCATCATTGACAGTGCTTTCTGTCTCACGAAATATGCTAAATGGAGCCATACCTCCTAATGCGTTCGATAATCTTCCCAATCTCCAGATATTATACATGGACCACAACCACTTCCATGGCCATATCCCTGCCTCACTGGCTAATGCTTCCAATCTGTTCATGATTGTCCTTGGTGCAAATCCTTTTAGTGGCATTGTTCCCAAAGAGGTTGGAGAGTTAAGAAATCTTAACCGACTAGTGCTCACGGATTCTTTAGTTGGAGCCAAGGAACCCAAAGATTGGGAATTCATAACTGCATTAACAAATTGCTCCCAGCTAGAGGTTTTAATACTTGGTATTTGTGAGTTCAATGGAACCCTTCCTGATTCACTTTCCAATCTTTCCACTTCGCTAAAAATTCTCTCCCTCTCAGCAAATGCAATTTCAGGAAGCATACCCAAAGATATTGGTAATCTCTTCAACCTACAAGTCCTTGACCTTGCCTATAACTCTTTCACAGGAAATCTTCCGTCATCCTTGGCTAAGCTTAAAAACTTGCAAAAGTTCTTTGTAAATGATAACTATATTAACGGATCATTCCCATTGGCAATAGGAAATCTCAGATACTTAATTTCACTGTACTTAATGTCTAATGCCTTCAGCGGTAGGTTGCCAAACACACTTGCAAATATGACAATGCTGTCGGAACTTTATCTTGCTAATAACAACTTCATAGGCACAATTCCTAGTGGTTTATTCAACATATCCACACTCTCTATAGGTTTGGACCTATCTTATAATAGCCTGGAGGGATCAATACCACAAGAAATAGGAAATCTAAAAAGTCTAGCCAAATTCAATGCAGAGTCAAACAAATTGTCAGGGGAAATCCCTGCCGCCCTAGGGGAATGTCAAGGTCTCCGGTATCTCTTCCTCCAAAATAACATCTTAAACGGTAACATCCCAGGACATCTTAGTCAACTGAAAAGTCTACAAAGGCTTGACCTCTCAAGCAATAATTTGTCTGAGGTACCAACTTTTGGTGTATTCGCTAATGCTACTGCAATCTCAATCCAACACAATGGCAAACTTTGCGGTGGGATGCCTGCTATGCATTTGCCTCCATGTCCTTTGCAGTTACCAAAGAACAAACATAAACTCCTAGTGATTCCTATTGTTACTTCTCTCGTTGGAACATTAATCATCCTTGTGTTGCTCTACAAGCTTCTTACTTGGCATAAAAGAAACAAAACGGAAATCCCTTCAATTACAACCATGCAGAGACAAAGACACCCACTTATCTCTTATTCAGAGTTGGTGAAAGCAACAGATGGTTTTTCAGCAACAAATTTGTTGGGTTCTGGTTCATTCGGTACCGTGTACAAAGGGGAGCTAGATGGTCAATTGGGTGAAAGCACGAACGTTGTTGCTGTGAAGGTGCTAAAACTTCAAACTCCTGGGGCCATGAAGAGTTTTGTAGCTGAATGCGAAGCACTACGGAACTTGAGACACCGAAATCTTGTCAAAATAGTTACAACTTGTTTGAGCATTGATCATAATGGGAATGACTTCAAAGCAATCGTGTATGAATTCATGCCTAATGGCAATTTAGAAGGTTGGCTGCATCCTGACACAGATGGGCAAATGGAACAGAAATTTTTGAATCTGATCGAGAGGGTGAGCATACTACTCGATGTGGCTTTTGCATTGGATTATCTTCATTGTCATGGTCTAGCACCTGTTATACATTGTGATCTTAAACCTAGTAATGTGCTCTTGGATGCTGATATGGTAGCCCATGTTGGAGACTTTGGACTTGCTAAAATTCTTGTTGAGGAAAGCTCAACTGTTCAACAGTCCATGAGCTCGATGGGACTTAAAGGAACAATCGGTTATGCTGCCCCAGAGTATGGTGCTGGGAACGTGGTGTCAACAAATGGAGACATCTACAGTTATGGAATTCTTGTGTTAGAAATGGTAACTGGTAGGAGGCCCACAGATAGCACCTTCAGAGAGGGATTAAGCCTCCGTGAATATGTTGAGCTGGCCCTGCATAATGGAACGATGGACGTCATTGACACGCGTCTGTCGTTGAGCCTCGAGAATGAATTTCAGGGTGTGGGTGAGGGTGATTCATCGCAAAATAGAAAGACTGATTGCCTGATTGCCCTACTTAAACTTGGATTGTCGTGCTCTGAGGAATTGCCATCCAGTAGGATGCCAACTGCAGACATCATCAGAGAGCTGCTTGTCATAAAAGGATCTATCTTGTAG


Protein sequences

Name Description Sequence
Si025889m Leucine-rich repeat protein kinase family protein (best arabidopsis hit); receptor-like protein kinase 2 precursor, putative, expressed (best rice hit)

MTLFFFSLFFFCSHALVSLGSSNATGDELALLSFKSMLSTPSKVSLASWNMSSHFCSWQGVVCGRRHPDRVVSLHLSSFDLSGRISPFLGNLSFLQKVELGNNQLVGHIPPELGRLSKLQELNLSTNFLQGSIPVAMGGCTNLMVLDLSNNQLQGEIPSVIGASMKNLVQLYLRKNLLTGVIPQSLAELSSIELLFLSHNNLDGEIPSALGNLTNLLSIGFSNNMLSGAIPSSLGMLPNLSMLSVGFNNLTGPIPTSIWNISSLTVLSVSRNMLNGAIPPNAFDNLPNLQILYMDHNHFHGHIPASLANASNLFMIVLGANPFSGIVPKEVGELRNLNRLVLTDSLVGAKEPKDWEFITALTNCSQLEVLILGICEFNGTLPDSLSNLSTSLKILSLSANAISGSIPKDIGNLFNLQVLDLAYNSFTGNLPSSLAKLKNLQKFFVNDNYINGSFPLAIGNLRYLISLYLMSNAFSGRLPNTLANMTMLSELYLANNNFIGTIPSGLFNISTLSIGLDLSYNSLEGSIPQEIGNLKSLAKFNAESNKLSGEIPAALGECQGLRYLFLQNNILNGNIPGHLSQLKSLQRLDLSSNNLSEVPTFGVFANATAISIQHNGKLCGGMPAMHLPPCPLQLPKNKHKLLVIPIVTSLVGTLIILVLLYKLLTWHKRNKTEIPSITTMQRQRHPLISYSELVKATDGFSATNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLRHRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTDSTFREGLSLREYVELALHNGTMDVIDTRLSLSLENEFQGVGEGDSSQNRKTDCLIALLKLGLSCSEELPSSRMPTADIIRELLVIKGSIL*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-1007 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MTLFFFSLFFFCSHALVSLGSSNATGDELALLSFKSMLSTPSKVSLASWNMSSHFCSWQGVVCGRRHPDRVVSLHLSSFDLSGRISPFLGNLSFLQKVELGNNQLVGHIPPELGRLSKLQELNLSTNFLQGSIPVAMGGCTNLMVLDLSNNQLQGEIPSVIGASMKNLVQLYLRKNLLTGVIPQSLAELSSIELLFLSHNNLDGEIPSALGNLTNLLSIGFSNNMLSGAIPSSLGMLPNLSMLSVGFNNLTGPIPTSIWNISSLTVLSVSRNMLNGAIPPNAFDNLPNLQILYMDHNHFHGHIPASLANASNLFMIVLGANPFSGIVPKEVGELRNLNRLVLTDSLVGAKEPKDWEFITALTNCSQLEVLILGICEFNGTLPDSLSNLSTSLKILSLSANAISGSIPKDIGNLFNLQVLDLAYNSFTGNLPSSLAKLKNLQKFFVNDNYINGSFPLAIGNLRYLISLYLMSNAFSGRLPNTLANMTMLSELYLANNNFIGTIPSGLFNISTLSIGLDLSYNSLEGSIPQEIGNLKSLAKFNAESNKLSGEIPAALGECQGLRYLFLQNNILNGNIPGHLSQLKSLQRLDLSSNNLSEVPTFGVFANATAISIQHNGKLCGGMPAMHLPPCPLQLPKNKHKLLVIPIVTSLVGTLIILVLLYKLLTWHKRNKTEIPSITTMQRQRHPLISYSELVKATDGFSATNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLRHRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTDSTFREGLSLREYVELALHNGTMDVIDTRLSLSLENEFQGVGEGDSSQNRKTDCLIALLKLGLSCSEELPSSRMPTADIIRELLVIK

HMMPanther: PTHR24420
1-1007 FAMILY NOT NAMED,FAMILY NOT NAMED

MTLFFFSLFFFCSHALVSLGSSNATGDELALLSFKSMLSTPSKVSLASWNMSSHFCSWQGVVCGRRHPDRVVSLHLSSFDLSGRISPFLGNLSFLQKVELGNNQLVGHIPPELGRLSKLQELNLSTNFLQGSIPVAMGGCTNLMVLDLSNNQLQGEIPSVIGASMKNLVQLYLRKNLLTGVIPQSLAELSSIELLFLSHNNLDGEIPSALGNLTNLLSIGFSNNMLSGAIPSSLGMLPNLSMLSVGFNNLTGPIPTSIWNISSLTVLSVSRNMLNGAIPPNAFDNLPNLQILYMDHNHFHGHIPASLANASNLFMIVLGANPFSGIVPKEVGELRNLNRLVLTDSLVGAKEPKDWEFITALTNCSQLEVLILGICEFNGTLPDSLSNLSTSLKILSLSANAISGSIPKDIGNLFNLQVLDLAYNSFTGNLPSSLAKLKNLQKFFVNDNYINGSFPLAIGNLRYLISLYLMSNAFSGRLPNTLANMTMLSELYLANNNFIGTIPSGLFNISTLSIGLDLSYNSLEGSIPQEIGNLKSLAKFNAESNKLSGEIPAALGECQGLRYLFLQNNILNGNIPGHLSQLKSLQRLDLSSNNLSEVPTFGVFANATAISIQHNGKLCGGMPAMHLPPCPLQLPKNKHKLLVIPIVTSLVGTLIILVLLYKLLTWHKRNKTEIPSITTMQRQRHPLISYSELVKATDGFSATNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLRHRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTDSTFREGLSLREYVELALHNGTMDVIDTRLSLSLENEFQGVGEGDSSQNRKTDCLIALLKLGLSCSEELPSSRMPTADIIRELLVIK

Seg: seg
3-11 seg

LFFFSLFFF

superfamily: SSF52058
21-277 L domain-like,LRR

SSNATGDELALLSFKSMLSTPSKVSLASWNMSSHFCSWQGVVCGRRHPDRVVSLHLSSFDLSGRISPFLGNLSFLQKVELGNNQLVGHIPPELGRLSKLQELNLSTNFLQGSIPVAMGGCTNLMVLDLSNNQLQGEIPSVIGASMKNLVQLYLRKNLLTGVIPQSLAELSSIELLFLSHNNLDGEIPSALGNLTNLLSIGFSNNMLSGAIPSSLGMLPNLSMLSVGFNNLTGPIPTSIWNISSLTVLSVSRNMLNGA

HMMPfam: PF08263
IPR013210
26-63 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

GDELALLSFKSMLSTPSKVSLASWNMSSHFCSWQGVVC

Gene3D: G3DSA:3.80.10.10
27-270 no description

DELALLSFKSMLSTPSKVSLASWNMSSHFCSWQGVVCGRRHPDRVVSLHLSSFDLSGRISPFLGNLSFLQKVELGNNQLVGHIPPELGRLSKLQELNLSTNFLQGSIPVAMGGCTNLMVLDLSNNQLQGEIPSVIGASMKNLVQLYLRKNLLTGVIPQSLAELSSIELLFLSHNNLDGEIPSALGNLTNLLSIGFSNNMLSGAIPSSLGMLPNLSMLSVGFNNLTGPIPTSIWNISSLTVLSVS

HMMSmart: SM00369
IPR003591
92-116 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSFLQKVELGNNQLVGHIPPELGRL

ProfileScan: PS51450
IPR001611
118-140 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQELNLSTNFLQGSIPVAMGGC

HMMPfam: PF00560
IPR001611
118-136 LRR_1
Leucine-rich repeat

KLQELNLSTNFLQGSIPVA

HMMSmart: SM00369
IPR003591
140-164 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

CTNLMVLDLSNNQLQGEIPSVIGAS

HMMPfam: PF13855
141-202 LRR_8,Leucine rich repeat

TNLMVLDLSNNQLQGEIPSVIGASMKNLVQLYLRKNLLTGVIPQSLAELSSIELLFLSHNNL

ProfileScan: PS51450
IPR001611
142-164 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLMVLDLSNNQLQGEIPSVIGAS

FPrintScan: PR00019
143-156 LEURICHRPT,Leucine-rich repeat signature

LMVLDLSNNQLQGE

HMMSmart: SM00369
IPR003591
165-188 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKNLVQLYLRKNLLTGVIPQSLAE

HMMSmart: SM00365
165-191 Leucine-rich repeat, SDS22-like subfamily

MKNLVQLYLRKNLLTGVIPQSLAELSS

ProfileScan: PS51450
IPR001611
167-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVQLYLRKNLLTGVIPQSLAELS

HMMSmart: SM00369
IPR003591
189-213 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSIELLFLSHNNLDGEIPSALGNL

ProfileScan: PS51450
IPR001611
191-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIELLFLSHNNLDGEIPSALGNLT

HMMSmart: SM00365
237-263 Leucine-rich repeat, SDS22-like subfamily

LPNLSMLSVGFNNLTGPIPTSIWNISS

HMMPfam: PF13855
238-299 LRR_8,Leucine rich repeat

PNLSMLSVGFNNLTGPIPTSIWNISSLTVLSVSRNMLNGAIPPNAFDNLPNLQILYMDHNHF

HMMSmart: SM00369
IPR003591
261-285 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

ISSLTVLSVSRNMLNGAIPPNAFDN

Gene3D: G3DSA:3.80.10.10
271-345 no description

RNMLNGAIPPNAFDNLPNLQILYMDHNHFHGHIPASLANASNLFMIVLGANPFSGIVPKEVGELRNLNRLVLTDS

superfamily: SSF52047
278-668 RNI-like,LRR

IPPNAFDNLPNLQILYMDHNHFHGHIPASLANASNLFMIVLGANPFSGIVPKEVGELRNLNRLVLTDSLVGAKEPKDWEFITALTNCSQLEVLILGICEFNGTLPDSLSNLSTSLKILSLSANAISGSIPKDIGNLFNLQVLDLAYNSFTGNLPSSLAKLKNLQKFFVNDNYINGSFPLAIGNLRYLISLYLMSNAFSGRLPNTLANMTMLSELYLANNNFIGTIPSGLFNISTLSIGLDLSYNSLEGSIPQEIGNLKSLAKFNAESNKLSGEIPAALGECQGLRYLFLQNNILNGNIPGHLSQLKSLQRLDLSSNNLSEVPTFGVFANATAISIQHNGKLCGGMPAMHLPPCPLQLPKNKHKLLVIPIVTSLVGTLIILVLLYKLLTWHK

HMMSmart: SM00369
IPR003591
286-310 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLQILYMDHNHFHGHIPASLANA

ProfileScan: PS51450
IPR001611
288-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQILYMDHNHFHGHIPASLANA

Gene3D: G3DSA:3.80.10.10
359-620 no description

TALTNCSQLEVLILGICEFNGTLPDSLSNLSTSLKILSLSANAISGSIPKDIGNLFNLQVLDLAYNSFTGNLPSSLAKLKNLQKFFVNDNYINGSFPLAIGNLRYLISLYLMSNAFSGRLPNTLANMTMLSELYLANNNFIGTIPSGLFNISTLSIGLDLSYNSLEGSIPQEIGNLKSLAKFNAESNKLSGEIPAALGECQGLRYLFLQNNILNGNIPGHLSQLKSLQRLDLSSNNLSEVPTFGVFANATAISIQHNGKLCG

HMMSmart: SM00365
389-415 Leucine-rich repeat, SDS22-like subfamily

STSLKILSLSANAISGSIPKDIGNLFN

ProfileScan: PS51450
IPR001611
391-413 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILSLSANAISGSIPKDIGNL

HMMSmart: SM00369
IPR003591
413-436 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LFNLQVLDLAYNSFTGNLPSSLAK

ProfileScan: PS51450
IPR001611
415-438 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLDLAYNSFTGNLPSSLAKLK

HMMPfam: PF00560
IPR001611
415-437 LRR_1
Leucine-rich repeat

NLQVLDLAYNSFTGNLPSSLAKL

HMMSmart: SM00369
IPR003591
485-509 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTMLSELYLANNNFIGTIPSGLFNI

ProfileScan: PS51450
IPR001611
487-509 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLSELYLANNNFIGTIPSGLFNI

ProfileScan: PS51450
IPR001611
511-534 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLSIGLDLSYNSLEGSIPQEIGNL

ProfileScan: PS51450
IPR001611
560-583 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRYLFLQNNILNGNIPGHLSQLK

HMMPfam: PF12799
561-601 LRR_4,Leucine Rich repeats (2 copies)

LRYLFLQNNILNGNIPGHLSQLKSLQRLDLSSNNLSEVPTF

FPrintScan: PR00019
582-595 LEURICHRPT,Leucine-rich repeat signature

LKSLQRLDLSSNNL

HMMSmart: SM00365
582-600 Leucine-rich repeat, SDS22-like subfamily

LKSLQRLDLSSNNLSEVPT

HMMSmart: SM00369
IPR003591
582-606 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLQRLDLSSNNLSEVPTFGVFAN

ProfileScan: PS51450
IPR001611
584-605 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQRLDLSSNNLSEVPTFGVFA

Seg: seg
654-664 seg

LIILVLLYKLL

superfamily: SSF56112
IPR011009
672-1007 Protein kinase-like (PK-like)
Protein kinase-like domain

TEIPSITTMQRQRHPLISYSELVKATDGFSATNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLRHRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTDSTFREGLSLREYVELALHNGTMDVIDTRLSLSLENEFQGVGEGDSSQNRKTDCLIALLKLGLSCSEELPSSRMPTADIIRELLVIK

Gene3D: G3DSA:3.30.200.20
682-757 no description

RQRHPLISYSELVKATDGFSATNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLR

ProfileScan: PS50011
IPR000719
700-1005 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSATNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLRHRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTDSTFREGLSLREYVELALHNGTMDVIDTRLSLSLENEFQGVGEGDSSQNRKTDCLIALLKLGLSCSEELPSSRMPTADIIRELLV

HMMSmart: SM00220
IPR002290
700-1005 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSATNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLRHRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTDSTFREGLSLREYVELALHNGTMDVIDTRLSLSLENEFQGVGEGDSSQNRKTDCLIALLKLGLSCSEELPSSRMPTADIIRELLV

HMMSmart: SM00219
IPR020635
700-1004 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSATNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLRHRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTDSTFREGLSLREYVELALHNGTMDVIDTRLSLSLENEFQGVGEGDSSQNRKTDCLIALLKLGLSCSEELPSSRMPTADIIRELL

HMMPfam: PF07714
IPR001245
703-921 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

TNLLGSGSFGTVYKGELDGQLGESTNVVAVKVLKLQTPGAMKSFVAECEALRNLRHRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTD

PatternScan: PS00107
IPR017441
706-733 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGSFGTVYKGELDGQLGESTNVVAVK

Gene3D: G3DSA:1.10.510.10
758-1003 no description

HRNLVKIVTTCLSIDHNGNDFKAIVYEFMPNGNLEGWLHPDTDGQMEQKFLNLIERVSILLDVAFALDYLHCHGLAPVIHCDLKPSNVLLDADMVAHVGDFGLAKILVEESSTVQQSMSSMGLKGTIGYAAPEYGAGNVVSTNGDIYSYGILVLEMVTGRRPTDSTFREGLSLREYVELALHNGTMDVIDTRLSLSLENEFQGVGEGDSSQNRKTDCLIALLKLGLSCSEELPSSRMPTADIIREL

PatternScan: PS00108
IPR008271
835-847 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHCDLKPSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox