PRGDB00181471 (Si025855m)

From PRG Wiki
Jump to: navigation, search
Si025855m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit); NB-ARC domain containing protein, putative (best rice hit)

DNA Sequence

ATGGCGCCTGCGGAGGAACAGGGCAAGGAAGTCAACGAGATCGCGCCTGCAGCTTCAGAGCAGCAGCAGGAAACGCAGGAGCGACATCAGATGCCGCCTGCAGCTTCCGAGAATAAGGAAAAGGAGGAGGTAGCCAAGATCGATGAGGTATTGAGTTGGCTGAAGCCCTTGCCGGCTAAAATCACTGAGCTGCTGGAATCTGCTGGCCCTCGCCGCGTCAGGGATCATCCTGAACGGCGCGCCCTGGAGTTCATGAAGATGGAGCTGACAGATCTTGTCGACTCACTGAAATCCATGCTGCCTCCATTGCAGGATGGTCGTGTTGGCGCCGAGCTCAAGATGGACTGGCTGAACAGATTGATTCTTTTCGCCAGAGATGCCCATAGCCTCGTCAAACAAGTTTCTGATTCCCGACTTCACACACTGCTGCGAAGAGCCACGCAGTTCTTCCGCCGTAGTAATAAAGTTTTGATGTATATGGCGGAAGAATCTTTCCGTGCAGCCGAATATGCAAGCAAGTATAGGTGCCTTCTTCTTGCCAGTAGCAGTTCCGTTGCCAGTGGCAGTTCCGACCACGCGCTGCCACCCTGCTCAGACCACCTCCTTTTTGGCATCGATCGCCCCATAAAGAAGCTCCTTGGATGGCTCACGTCTCAGGAGGAGACGGAAGAAAGGGGGCTAAAGTTCATAGCCATTGTTGGAGCTGCCGGGATGGGCAAGACAACTCTTGCCATGGAGCTCCACCGCCGGCTCCAGTGCCAAGCTAGCGGTGGATACAACTCTTTCCAGTGCAATGCTGTGGCTCAGGTGTCTAATAGTACTCGAAGAATGGAGCTTCTTCTCAGGGACATCCTCTCACGAATTTCATACGGCACATCACCACTGCTACCATCTGATCAATCACCATCCAAGACGACGGAGCTACTAGTTTACCGCGTTCGAGAATACCTGCAAGATAAGAGGTACTTCATCTTAATTGATGATTTGTGGCACAGAGAAGATTGGGAAGAAATCAAAGGTGCCTTTCCTAATAATAATCTTGATAGCCGATTATTGATTACAACACGTGTTGAAAGTATAGCATGGTCATGTTGTTCTGATTCTAAAGGTTTGCTTGTGCACGAGATGAAACCTTTGAATCAGATGGATTCAGAAAGGCTGCTTTTAGTAAAAGCTTTTGGTTCTGTTGATGGTTGCCCGTCAGACAGCATGAAGCTATTCTGCGATAAAATCCTGATGACATGTCAAGGTATACCATTGTTCGTAACTGGCACGGCAGATTGGTTGAAAGAACAATTGCAGCTGCAGCAGAAGCAGCAGAGGTATGCAATTTGTAGCGAGGAACAAGTCCCCCAGCTACCAGAACTATTTGAACAAGAACTGTCCTCTGCTTTTGATGACCTTCCTTCTGAGCTACCAGAACTATTTGGACAAGAACTGTCCTCTGCTTTCGGTGACCTTCCTTCTGAGCTACCAGAACTATTTGAACAAGAACTTATGTTTCCTTATTGTTACAGCTTTGAGAAGGATCATCTTATCTTGAAATGGATTTCTGAGTGCCATACCAGTTGGCCAGAATATTATGTTATTCGTAAACGTAAGGAAGAAGGAAATGAGTACTTCTCCCAGCTAGTCGACAGGAATGTCATTTCCAGTGCAGCAGCAAATTGCAAACCCGGTTTGAGTGAAGACGAGGCCTGCCAGTGGCATATAAATCAATTTATGCAGCAGTTCCTTGCCTCCAAATCTGCAAAGATAGGTTTTGCTTTCACCAGCACCACGCTGACGGGTAATGTAACTAGGATGCCAAGGAGGCTAGCCCTCCATCATCCTGATCCCCTGCTCCCATCAGAGATTCAGACTAAGGATTTGTCCCAAACTCGTTGGCTAACTGTATCTGGTTCGGTCAGTGCGATCCCTGTTAACATGTTTGTCAATTTAGTGGTGCTGGATCTTGAAGGTTGGGATAATTTTAATAACCAGGACCTAGAGGAGATATGCAGAGGCAAAATGTTTGTTTTGGAGTATTTGAGCATTAGGAAGACTCGAGTGAGCAAGCTCCCACATGAGATCAAGGACCTGCAGAATCTGATGATATTGGATGTAAGTTGCACCACGATAAGTGTGCTTCCGTCTGGAGTGTTCAAGCTAAAAAGATTGTACCATCTGGATCTAAGAGGCACAGCGATAAGGAAACTGACAAACGAAATTGTGGGGCTACAGAGTACTTTGCATGCTCTTCTTGTTGGTGATGAAGGAATGATTAATTCCGTTGAAGCGGCAACATGGGTACCACACGATATACAGCGTTTTCACGCACTACATACACTAGCAACTATAGATTTAACTGGACAAGCCGAAAGCTTCATCCAGGCTCTTGGAGATCTACACACTCTGAGGGTGCTGGCAGTAACATGGTCTTTTCACCAGAGCACTGACAGAGCATGCCGTCAAGCATTAGAATCATCCATCCAGAAGTTGCATAGGCTCGAGTCTCTGACAATTCACTGTGGACTCGGCTGCTCCATGGAGTTCCTAGGTGTGTCTGATAACTGTAGGCCCTGGACGCTCGAGAAGTTCAAGGTGACAGCTGGAAGATTTGCACGCGTTCCCAGGTGGATCGACAACTACCAAAAGCTTCTACGTTTCGTGCAAATCACCGTCTGCAGACTAGAGACGGATGATCTCAAGAGGCTTGGAGAATTGCTCCAACTTCAGTTCTTAACACTAGGCTTGGACTTCGTCCCCGAAGAAGCTATAGTGATCGATAAGGCGGGGTTCAGTGAGCTTCAGAGATTCTCCGTCGACTGCCAAATGCCATGGCTCACTTTCAAGACAGGAGCTATGCGGAAGCTCAGATATCTTCAACTGACATTCAACACATGCCCTGCGAGCAGCCAGACCCAGACTAATGTTCCGTCAGGTATCGGCAGCCTCCAAAGTCTTTCTGAGGTAGCCTTGTGCTACAACGCAAGGTACAGCACCAGGCCCAGCGTCAAGGCGACAGTGGAGGCAGCGAGGAAACAAGTCGCAGAGAACCCCAACCAGATCGACCTTTTCATCAATGGCCACCAAGACTACGATGTTCAAGAAGCTGATGAGGAGACAGAGAATGCGAACGGAACCATCAGACGAGTTGATGCTGAAACCAAATGTGATGCTCGAGCAGTCCTTGAGGAGGCAAGCAGGAGGACTACAGAAGAGTATCAGAGTGAGATCGAAGCTGAAGCTGATGCCCGGAGCGACTCCTAG


Protein sequences

Name Description Sequence
Si025855m NB-ARC domain-containing disease resistance protein (best arabidopsis hit); NB-ARC domain containing protein, putative (best rice hit)

MAPAEEQGKEVNEIAPAASEQQQETQERHQMPPAASENKEKEEVAKIDEVLSWLKPLPAKITELLESAGPRRVRDHPERRALEFMKMELTDLVDSLKSMLPPLQDGRVGAELKMDWLNRLILFARDAHSLVKQVSDSRLHTLLRRATQFFRRSNKVLMYMAEESFRAAEYASKYRCLLLASSSSVASGSSDHALPPCSDHLLFGIDRPIKKLLGWLTSQEETEERGLKFIAIVGAAGMGKTTLAMELHRRLQCQASGGYNSFQCNAVAQVSNSTRRMELLLRDILSRISYGTSPLLPSDQSPSKTTELLVYRVREYLQDKRYFILIDDLWHREDWEEIKGAFPNNNLDSRLLITTRVESIAWSCCSDSKGLLVHEMKPLNQMDSERLLLVKAFGSVDGCPSDSMKLFCDKILMTCQGIPLFVTGTADWLKEQLQLQQKQQRYAICSEEQVPQLPELFEQELSSAFDDLPSELPELFGQELSSAFGDLPSELPELFEQELMFPYCYSFEKDHLILKWISECHTSWPEYYVIRKRKEEGNEYFSQLVDRNVISSAAANCKPGLSEDEACQWHINQFMQQFLASKSAKIGFAFTSTTLTGNVTRMPRRLALHHPDPLLPSEIQTKDLSQTRWLTVSGSVSAIPVNMFVNLVVLDLEGWDNFNNQDLEEICRGKMFVLEYLSIRKTRVSKLPHEIKDLQNLMILDVSCTTISVLPSGVFKLKRLYHLDLRGTAIRKLTNEIVGLQSTLHALLVGDEGMINSVEAATWVPHDIQRFHALHTLATIDLTGQAESFIQALGDLHTLRVLAVTWSFHQSTDRACRQALESSIQKLHRLESLTIHCGLGCSMEFLGVSDNCRPWTLEKFKVTAGRFARVPRWIDNYQKLLRFVQITVCRLETDDLKRLGELLQLQFLTLGLDFVPEEAIVIDKAGFSELQRFSVDCQMPWLTFKTGAMRKLRYLQLTFNTCPASSQTQTNVPSGIGSLQSLSEVALCYNARYSTRPSVKATVEAARKQVAENPNQIDLFINGHQDYDVQEADEETENANGTIRRVDAETKCDARAVLEEASRRTTEEYQSEIEAEADARSDS*

Domains

Domain Start-End Description Sequence

Seg: seg
177-194 seg

LLLASSSSVASGSSDHAL

Gene3D: G3DSA:3.40.50.300
197-329 no description

CSDHLLFGIDRPIKKLLGWLTSQEETEERGLKFIAIVGAAGMGKTTLAMELHRRLQCQASGGYNSFQCNAVAQVSNSTRRMELLLRDILSRISYGTSPLLPSDQSPSKTTELLVYRVREYLQDKRYFILIDDL

HMMPanther: PTHR23155
199-1034 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DHLLFGIDRPIKKLLGWLTSQEETEERGLKFIAIVGAAGMGKTTLAMELHRRLQCQASGGYNSFQCNAVAQVSNSTRRMELLLRDILSRISYGTSPLLPSDQSPSKTTELLVYRVREYLQDKRYFILIDDLWHREDWEEIKGAFPNNNLDSRLLITTRVESIAWSCCSDSKGLLVHEMKPLNQMDSERLLLVKAFGSVDGCPSDSMKLFCDKILMTCQGIPLFVTGTADWLKEQLQLQQKQQRYAICSEEQVPQLPELFEQELSSAFDDLPSELPELFGQELSSAFGDLPSELPELFEQELMFPYCYSFEKDHLILKWISECHTSWPEYYVIRKRKEEGNEYFSQLVDRNVISSAAANCKPGLSEDEACQWHINQFMQQFLASKSAKIGFAFTSTTLTGNVTRMPRRLALHHPDPLLPSEIQTKDLSQTRWLTVSGSVSAIPVNMFVNLVVLDLEGWDNFNNQDLEEICRGKMFVLEYLSIRKTRVSKLPHEIKDLQNLMILDVSCTTISVLPSGVFKLKRLYHLDLRGTAIRKLTNEIVGLQSTLHALLVGDEGMINSVEAATWVPHDIQRFHALHTLATIDLTGQAESFIQALGDLHTLRVLAVTWSFHQSTDRACRQALESSIQKLHRLESLTIHCGLGCSMEFLGVSDNCRPWTLEKFKVTAGRFARVPRWIDNYQKLLRFVQITVCRLETDDLKRLGELLQLQFLTLGLDFVPEEAIVIDKAGFSELQRFSVDCQMPWLTFKTGAMRKLRYLQLTFNTCPASSQTQTNVPSGIGSLQSLSEVALCYNARYSTRPSVKATVEAARKQVAENPNQIDLFINGHQDYDVQEADE

HMMPanther: PTHR23155:SF86
199-1034 OS11G0605100 PROTEIN,OS11G0605100 PROTEIN

DHLLFGIDRPIKKLLGWLTSQEETEERGLKFIAIVGAAGMGKTTLAMELHRRLQCQASGGYNSFQCNAVAQVSNSTRRMELLLRDILSRISYGTSPLLPSDQSPSKTTELLVYRVREYLQDKRYFILIDDLWHREDWEEIKGAFPNNNLDSRLLITTRVESIAWSCCSDSKGLLVHEMKPLNQMDSERLLLVKAFGSVDGCPSDSMKLFCDKILMTCQGIPLFVTGTADWLKEQLQLQQKQQRYAICSEEQVPQLPELFEQELSSAFDDLPSELPELFGQELSSAFGDLPSELPELFEQELMFPYCYSFEKDHLILKWISECHTSWPEYYVIRKRKEEGNEYFSQLVDRNVISSAAANCKPGLSEDEACQWHINQFMQQFLASKSAKIGFAFTSTTLTGNVTRMPRRLALHHPDPLLPSEIQTKDLSQTRWLTVSGSVSAIPVNMFVNLVVLDLEGWDNFNNQDLEEICRGKMFVLEYLSIRKTRVSKLPHEIKDLQNLMILDVSCTTISVLPSGVFKLKRLYHLDLRGTAIRKLTNEIVGLQSTLHALLVGDEGMINSVEAATWVPHDIQRFHALHTLATIDLTGQAESFIQALGDLHTLRVLAVTWSFHQSTDRACRQALESSIQKLHRLESLTIHCGLGCSMEFLGVSDNCRPWTLEKFKVTAGRFARVPRWIDNYQKLLRFVQITVCRLETDDLKRLGELLQLQFLTLGLDFVPEEAIVIDKAGFSELQRFSVDCQMPWLTFKTGAMRKLRYLQLTFNTCPASSQTQTNVPSGIGSLQSLSEVALCYNARYSTRPSVKATVEAARKQVAENPNQIDLFINGHQDYDVQEADE

superfamily: SSF52540
202-394 P-loop containing nucleoside triphosphate hydrolases

LFGIDRPIKKLLGWLTSQEETEERGLKFIAIVGAAGMGKTTLAMELHRRLQCQASGGYNSFQCNAVAQVSNSTRRMELLLRDILSRISYGTSPLLPSDQSPSKTTELLVYRVREYLQDKRYFILIDDLWHREDWEEIKGAFPNNNLDSRLLITTRVESIAWSCCSDSKGLLVHEMKPLNQMDSERLLLVKAFG

HMMPfam: PF00931
IPR002182
206-519 NB-ARC,NBS
NB-ARC

DRPIKKLLGWLTSQEETEERGLKFIAIVGAAGMGKTTLAMELHRRLQCQASGGYNSFQCNAVAQVSNSTRRMELLLRDILSRISYGTSPLLPSDQSPSKTTELLVYRVREYLQDKRYFILIDDLWHREDWEEIKGAFPNNNLDSRLLITTRVESIAWSCCSDSKGLLVHEMKPLNQMDSERLLLVKAFGSVDGCPSDSMKLFCDKILMTCQGIPLFVTGTADWLKEQLQLQQKQQRYAICSEEQVPQLPELFEQELSSAFDDLPSELPELFGQELSSAFGDLPSELPELFEQELMFPYCYSFEKDHLILKWISE

FPrintScan: PR00364
IPR000767
229-244 DISEASERSIST
Disease resistance protein

FIAIVGAAGMGKTTLA

FPrintScan: PR00364
IPR000767
316-330 DISEASERSIST
Disease resistance protein

YLQDKRYFILIDDLW

FPrintScan: PR00364
IPR000767
415-429 DISEASERSIST
Disease resistance protein

CQGIPLFVTGTADWL

Seg: seg
429-440 seg

LKEQLQLQQKQQ

superfamily: SSF52047
624-960 RNI-like,LRR

LSQTRWLTVSGSVSAIPVNMFVNLVVLDLEGWDNFNNQDLEEICRGKMFVLEYLSIRKTRVSKLPHEIKDLQNLMILDVSCTTISVLPSGVFKLKRLYHLDLRGTAIRKLTNEIVGLQSTLHALLVGDEGMINSVEAATWVPHDIQRFHALHTLATIDLTGQAESFIQALGDLHTLRVLAVTWSFHQSTDRACRQALESSIQKLHRLESLTIHCGLGCSMEFLGVSDNCRPWTLEKFKVTAGRFARVPRWIDNYQKLLRFVQITVCRLETDDLKRLGELLQLQFLTLGLDFVPEEAIVIDKAGFSELQRFSVDCQMPWLTFKTGAMRKLRYLQLTFN

HMMPfam: PF13855
674-730 LRR_8,Leucine rich repeat

LEYLSIRKTRVSKLPHEIKDLQNLMILDVSCTTISVLPSGVFKLKRLYHLDLRGTAI

FPrintScan: PR00364
IPR000767
692-708 DISEASERSIST
Disease resistance protein

KDLQNLMILDVSCTTIS

Gene3D: G3DSA:3.80.10.10
789-998 no description

FIQALGDLHTLRVLAVTWSFHQSTDRACRQALESSIQKLHRLESLTIHCGLGCSMEFLGVSDNCRPWTLEKFKVTAGRFARVPRWIDNYQKLLRFVQITVCRLETDDLKRLGELLQLQFLTLGLDFVPEEAIVIDKAGFSELQRFSVDCQMPWLTFKTGAMRKLRYLQLTFNTCPASSQTQTNVPSGIGSLQSLSEVALCYNARYSTRPS

Seg: seg
896-912 seg

LKRLGELLQLQFLTLGL

Coil: coil
1029-1050 coiled-coil

VQEADEETENANGTIRRVDAET






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox